Target Information

Target General Infomation
Target ID
T73097
Former ID
TTDS00442
Target Name
Granulocyte-macrophage colony-stimulating factor receptor alpha chain
Gene Name
CSF2RA
Synonyms
CD116 antigen; CDw116; GM-CSF-R-alpha; GM-CSFR; GMR; CSF2RA
Target Type
Successful
Disease Acute myeloid leukemia; Chronic myeloid leukemia [ICD9: 205.0, 205.1, 238.7; ICD10: C92.0, C92.1, D46]
Bone marrow transplantation [ICD9: 279.5, 996; ICD10: D89.8, T86]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Glioblastoma multiforme [ICD9: 191; ICD10: C71]
Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26]
Indolent follicular lymphoma [ICD9: 202.0, 202.8; ICD10: C81-C86, C82]
Multiple myeloma [ICD9: 203; ICD10: C90]
Multiple scierosis [ICD9: 340; ICD10: G35]
Neutropenia [ICD9: 288; ICD10: D70]
Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Stage III colorectal cancer [ICD9: 140-229, 153, 154; ICD10: C18-C21, C20]
Wound healing [ICD10: T14.0-T14.1]
Function
Low affinity receptor for granulocyte-macrophage colony- stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.
BioChemical Class
Type I cytokine receptor
UniProt ID
P15509
Sequence
MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKC
FLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTA
AQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHL
DNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQP
RTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAAD
VRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVP
QIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
Drugs and Mode of Action
Drug(s) Sargramostim Drug Info Approved Bone marrow transplantation [536361], [542827]
B-cell lymphoma vaccine Drug Info Preregistration Indolent follicular lymphoma [546162]
Pixykine Drug Info Phase 3 Human immunodeficiency virus infection [521422]
AFTVac Drug Info Phase 2 Glioblastoma multiforme [526997]
Colorectal cancer vaccine Drug Info Phase 2 Stage III colorectal cancer [549875]
GM-CSF cancer vaccine Drug Info Phase 2 Cancer [551058]
Leukemia cancer vaccine Drug Info Phase 2 Acute myeloid leukemia; Chronic myeloid leukemia [524918]
Mavrilimumab Drug Info Phase 2 Rheumatoid arthritis [542737], [551134]
Myeloma cancer vaccine Drug Info Phase 2 Multiple myeloma [524918]
Pancreatic cancer vaccine Drug Info Phase 2 Pancreatic cancer [550207]
MOR-103 Drug Info Phase 1/2 Multiple scierosis [522875]
KH-901 Drug Info Phase 1 Solid tumours [529983]
Molgramostim Drug Info Phase 1 Wound healing [525225]
SDZ-62-826 Drug Info Terminated Cancer [545716]
Stimulator BBT-007 Drug Info [543463]
Agonist Molgramostim Drug Info [550807]
Modulator Pixykine Drug Info
SDZ-62-826 Drug Info [543463]
Binder Sargramostim Drug Info [535373], [535772]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Hematopoietic cell lineage
Pathways in cancer
NetPath Pathway IL3 Signaling Pathway
RANKL Signaling Pathway
Pathway Interaction Database GMCSF-mediated signaling events
Alpha9 beta1 integrin signaling events
Reactome GPVI-mediated activation cascade
gamma signalling through PI3Kgamma
Interleukin-3, 5 and GM-CSF signaling
RAF/MAP kinase cascade
Surfactant metabolism
Interleukin receptor SHC signaling
WikiPathways Interleukin-2 signaling
Interleukin-3, 5 and GM-CSF signaling
References
Ref 521422ClinicalTrials.gov (NCT00001338) A Prospective, Randomized, Phase III Trial of FLAC (5-Fluorouracil, Leucovorin, Adriamycin, Cytoxan) Chemotherapy With GM-CSF (Granulocyte-Macrophage Colony-Stimulating Factor) Versus PIXY 321 in Advanced Breast Cancer. U.S. National Institutes of Health.
Ref 522875ClinicalTrials.gov (NCT01023256) Safety and Preliminary Efficacy of MOR103 in Patients With Active Rheumatoid Arthritis. U.S. National Institutes of Health.
Ref 524918ClinicalTrials.gov (NCT02243371) GVAX Pancreas Vaccine (With CY) and CRS-207 With or Without Nivolumab. U.S. National Institutes of Health.
Ref 525225ClinicalTrials.gov (NCT02468908) Inhaled Molgramostim (rhGM-CSF) in Healthy Adult Subjects.
Ref 526997Phase II randomized trial of autologous formalin-fixed tumor vaccine for postsurgical recurrence of hepatocellular carcinoma. Clin Cancer Res. 2004 Mar 1;10(5):1574-9.
Ref 529983A Phase I study of KH901, a conditionally replicating granulocyte-macrophage colony-stimulating factor: armed oncolytic adenovirus for the treatment of head and neck cancers. Cancer Biol Ther. 2009 Apr;8(8):676-82. Epub 2009 Apr 22.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 542737(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7785).
Ref 542827(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7905).
Ref 545716Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004355)
Ref 546162Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006688)
Ref 549875Clinical pipeline report, company report or official report of Aduro BioTech.
Ref 550207Clinical pipeline report, company report or official report of Aduro.
Ref 551058A safety and efficacy trial of lethally irradiated allogeneic pancreatic tumor cells transfected with the GM-CSF gene in combination with adjuvant chemoradiotherapy for the treatment of adenocarcinoma of the pancreas. Journal of Clinical Oncology, Vol 25, No 18S (June 20 Supplement), 2007: 3010.
Ref 551134Clinical pipeline report, company report or official report of MedImmune (2011).
Ref 526997Phase II randomized trial of autologous formalin-fixed tumor vaccine for postsurgical recurrence of hepatocellular carcinoma. Clin Cancer Res. 2004 Mar 1;10(5):1574-9.
Ref 527643Vaccines in cancer: GVAX, a GM-CSF gene vaccine. Expert Rev Vaccines. 2005 Jun;4(3):259-74.
Ref 528926Effects of KH901, a tumor-specific oncolytic recombinant adenovirus, on antitumor and expressing GM-CSF in xenograft tumor models. Sichuan Da Xue Xue Bao Yi Xue Ban. 2007 Jun;38(3):386-90.
Ref 532676MOR103, a human monoclonal antibody to granulocyte-macrophage colony-stimulating factor, in the treatment of patients with moderate rheumatoid arthritis: results of a phase Ib/IIa randomised, double-blind, placebo-controlled, dose-escalation trial. Ann Rheum Dis. 2015 Jun;74(6):1058-64.
Ref 535373Economic evaluation of filgrastim, sargramostim, and sequential sargramostim and filgrastim after myelosuppressive chemotherapy. Bone Marrow Transplant. 2002 Jan;29(2):159-64.
Ref 535772Stem cell transplantation and hematopoietic growth factors. Curr Hematol Rep. 2002 Nov;1(2):103-9.
Ref 543463(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1707).
Ref 549981Idiotypevaccinetherapy (BiovaxID) infollicularlymphomain first complete remission: Phase III clinical trial results, Journal of Clinical Oncology, Vol 27, No 18S (June 20 Supplement), 2009: 2.
Ref 550807Clinical pipeline report, company report or official report of gensci-china.
Ref 551134Clinical pipeline report, company report or official report of MedImmune (2011).

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.