Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T85228
|
||||
Former ID |
TTDI02253
|
||||
Target Name |
mRNA of CCR3 chemokine
|
||||
Gene Name |
CCR3
|
||||
Synonyms |
CC CKR3 (mRNA); CC chemokine receptor type 3 (mRNA); CCCKR3 (mRNA); CCR3 (mRNA); CD193 (mRNA); CKR3 (mRNA); Eosinophil eotaxin receptor (mRNA); CCR3
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Allergic asthma [ICD9: 493, 995.3; ICD10: J45, T78.4] | ||||
Function |
Receptor for a C-C type chemokine. Binds to eotaxin, eotaxin-3, MCP-3, MCP-4, RANTES and MIP-1 delta. Subsequently transduces a signal by increasing the intracellular calcium ions level. Alternative coreceptor with CD4 for HIV-1 infection.
|
||||
BioChemical Class |
Target of antisense drug
|
||||
UniProt ID | |||||
Sequence |
MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI
KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
NetPath Pathway | IL3 Signaling Pathway | ||||
PANTHER Pathway | Inflammation mediated by chemokine and cytokine signaling pathway | ||||
References | |||||
Ref 526362 | CCR3 antagonists: a potential new therapy for the treatment of asthma. Discovery and structure-activity relationships. Bioorg Med Chem Lett. 2002 Jul 8;12(13):1785-9. | ||||
Ref 526363 | Responses of leukocytes to chemokines in whole blood and their antagonism by novel CC-chemokine receptor 3 antagonists. Am J Respir Crit Care Med. 2002 Jun 15;165(12):1602-9. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.