Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T26623
|
||||
Former ID |
TTDS00115
|
||||
Target Name |
Aldose reductase
|
||||
Gene Name |
AKR1B1
|
||||
Synonyms |
AR; Aldehyde reductase; AKR1B1
|
||||
Target Type |
Successful
|
||||
Disease | Diabetic complication [ICD10: E08-E13] | ||||
Diabetic cataract [ICD10: E10.36, E11.36] | |||||
Diabetic neuropathy [ICD9: 250, 250.6, 356.0, 356.8; ICD10: E11.40] | |||||
Diabetes [ICD9: 253.5, 588.1; ICD10: E23.2, N25.1] | |||||
Glaucoma [ICD9: 365; ICD10: H40-H42] | |||||
Gout [ICD9: 274.00274.1274.8274.9; ICD10: M10] | |||||
Head and neck cancer [ICD9: 140-149, 140-229; ICD10: C07-C14, C32-C33] | |||||
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
Function |
Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies.
|
||||
BioChemical Class |
Short-chain dehydrogenases reductases
|
||||
Target Validation |
T26623
|
||||
UniProt ID | |||||
EC Number |
EC 1.1.1.21
|
||||
Sequence |
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA LLSCTSHKDYPFHEEF |
||||
Drugs and Mode of Action | |||||
Drug(s) | Epalrestat | Drug Info | Approved | Diabetic neuropathy | [1] |
Sulindac | Drug Info | Approved | Rheumatoid arthritis | [2], [3] | |
Fidarestat | Drug Info | Phase 3 | Diabetes | [4] | |
Ranirestat | Drug Info | Phase 3 | Diabetic neuropathy | [5] | |
ADMVA | Drug Info | Phase 2 | Diabetes | [6], [7] | |
LIDORESTAT | Drug Info | Phase 2 | Diabetic complication | [8], [9] | |
M-16209 | Drug Info | Phase 2 | Diabetes | [10] | |
QR-333 | Drug Info | Phase 2 | Diabetic neuropathy | [11] | |
T2c-003 | Drug Info | Phase 1/2 | Diabetic neuropathy | [12] | |
ALO-1567 | Drug Info | Phase 1 | Glaucoma | [13] | |
ARI-809 | Drug Info | Preclinical | Diabetes | [14] | |
Tolrestat | Drug Info | Withdrawn from market | Diabetic cataract | [15], [16] | |
IMIRESTAT | Drug Info | Discontinued in Phase 3 | Diabetes | [17] | |
MINALRESTAT | Drug Info | Discontinued in Phase 3 | Diabetes | [18] | |
Ponalrestat | Drug Info | Discontinued in Phase 3 | Gout | [19] | |
AD-5467 | Drug Info | Discontinued in Phase 2 | Diabetes | [20] | |
Alrestatin | Drug Info | Discontinued in Phase 2 | Discovery agent | [21] | |
CTL-102-GDEPT | Drug Info | Discontinued in Phase 2 | Head and neck cancer | [22] | |
JTT-811 | Drug Info | Discontinued in Phase 2 | Diabetic complication | [23] | |
ZOPOLRESTAT | Drug Info | Discontinued in Phase 2 | Diabetic complication | [24], [25] | |
E-0722 | Drug Info | Terminated | Diabetic cataract | [26] | |
FR-62765 | Drug Info | Terminated | Diabetes | [27] | |
Sorbinil | Drug Info | Terminated | Diabetic cataract | [28], [29] | |
SPR-210 | Drug Info | Terminated | Diabetic complication | [30] | |
WF-2421 | Drug Info | Terminated | Diabetes | [31] | |
Zenarestat | Drug Info | Terminated | Diabetic neuropathy | [32], [33] | |
Inhibitor | (4-Methyl-2-oxo-2H-quinolin-1-yl)-acetic acid | Drug Info | [34] | ||
(6-Hydroxy-2-oxo-2H-quinolin-1-yl)-acetic acid | Drug Info | [34] | |||
(6-Methoxy-2-oxo-2H-quinolin-1-yl)-acetic acid | Drug Info | [34] | |||
(8-Hydroxy-2-oxo-2H-quinolin-1-yl)-acetic acid | Drug Info | [34] | |||
2'-Monophosphoadenosine 5'-Diphosphoribose | Drug Info | [35] | |||
2,3-dihydroxypropanal | Drug Info | [36] | |||
2-(3,4-Dihydroxy-benzyl)-7-hydroxy-chromen-4-one | Drug Info | [37] | |||
2-(3,4-Dihydroxy-phenyl)-7-hydroxy-chromen-4-one | Drug Info | [37] | |||
2-(3-benzoyl-1H-pyrrol-1-yl)acetic acid | Drug Info | [38] | |||
2-(4-aminophenylsulfonamido)acetic acid | Drug Info | [39] | |||
2-(Phenylsulfonamido)acetic Acid | Drug Info | [40] | |||
2-Benzhydryl-7-hydroxy-chromen-4-one | Drug Info | [37] | |||
2-Benzyl-7-hydroxy-chromen-4-one | Drug Info | [37] | |||
3,5-dichlorosalicylic acid | Drug Info | [41] | |||
3-(3-Benzoyl-1H-pyrrol-1-yl)propanoic acid | Drug Info | [38] | |||
3-[5-(3-nitrophenyl)thiophen-2-yl]propanoic acid | Drug Info | [42] | |||
4-(3-Benzoyl-1H-pyrrol-1-yl)butanoic acid | Drug Info | [38] | |||
4-(3-Methoxy-phenyl)-isoxazolidine-3,5-dione | Drug Info | [43] | |||
6,7-Dihydroxy-2-phenyl-chromen-4-one | Drug Info | [37] | |||
6-(1H-Indole-2-sulfonyl)-2H-pyridazin-3-one | Drug Info | [44] | |||
6-(2-Bromo-benzenesulfonyl)-2H-pyridazin-3-one | Drug Info | [44] | |||
6-(2-Chloro-benzenesulfonyl)-2H-pyridazin-3-one | Drug Info | [44] | |||
6-(2-Fluoro-benzenesulfonyl)-2H-pyridazin-3-one | Drug Info | [44] | |||
6-(3-Chloro-benzenesulfonyl)-2H-pyridazin-3-one | Drug Info | [44] | |||
6-(4-Bromo-benzenesulfonyl)-2H-pyridazin-3-one | Drug Info | [44] | |||
6-(4-Chloro-benzenesulfonyl)-2H-pyridazin-3-one | Drug Info | [44] | |||
6-(4-Fluoro-benzenesulfonyl)-2H-pyridazin-3-one | Drug Info | [44] | |||
6-(4-Methoxy-benzenesulfonyl)-2H-pyridazin-3-one | Drug Info | [44] | |||
6-(Benzofuran-2-sulfonyl)-2H-pyridazin-3-one | Drug Info | [44] | |||
6-(Benzothiazole-2-sulfonyl)-2H-pyridazin-3-one | Drug Info | [44] | |||
6-(Biphenyl-2-sulfonyl)-2H-pyridazin-3-one | Drug Info | [44] | |||
6-(Naphthalene-1-sulfonyl)-2H-pyridazin-3-one | Drug Info | [44] | |||
6-(Naphthalene-2-sulfonyl)-2H-pyridazin-3-one | Drug Info | [44] | |||
6-(Toluene-4-sulfonyl)-2H-pyridazin-3-one | Drug Info | [44] | |||
6-Benzenesulfonyl-2H-pyridazin-3-one | Drug Info | [44] | |||
6-Hydroxy-2-(4-hydroxy-benzyl)-chromen-4-one | Drug Info | [37] | |||
6-methoxykaempferol 3-O-beta-D-robinobioside | Drug Info | [45] | |||
6-Phenylmethanesulfonyl-2H-pyridazin-3-one | Drug Info | [44] | |||
7-Hydroxy-2-(4-hydroxy-benzyl)-chromen-4-one | Drug Info | [37] | |||
7-Hydroxy-2-(4-methoxy-benzyl)-chromen-4-one | Drug Info | [37] | |||
7-Hydroxy-4-phenylcoumarin | Drug Info | [46] | |||
7-Hydroxy-6-nitro-2-phenyl-chromen-4-one | Drug Info | [37] | |||
AD-5467 | Drug Info | [47], [48] | |||
AK198 | Drug Info | [49] | |||
ALO-1567 | Drug Info | [13], [48] | |||
Alpha-D-Glucose-6-Phosphate | Drug Info | [35] | |||
Alrestatin | Drug Info | [35] | |||
APIGENIN | Drug Info | [50] | |||
Apigenin-7-O-beta-D-glucuronide | Drug Info | [50] | |||
Apigenin-7-O-beta-D-glucuronide methyl ester | Drug Info | [50] | |||
ARI-809 | Drug Info | [51] | |||
ASTRAGALIN | Drug Info | [50] | |||
CHRYSIN | Drug Info | [52] | |||
CONTIGOSIDE B | Drug Info | [53] | |||
DIADZEIN | Drug Info | [37] | |||
Epalrestat | Drug Info | [54], [55] | |||
EPALRESTATE | Drug Info | [50] | |||
Fidarestat | Drug Info | [56], [57] | |||
Fidarestat(Stereoisomer) | Drug Info | [35] | |||
Hydroxydimethylarsine Oxide | Drug Info | [35] | |||
IDD552 | Drug Info | [35] | |||
IDD594 | Drug Info | [42] | |||
IMIRESTAT | Drug Info | [58] | |||
Inhibitor Idd 384 | Drug Info | [35] | |||
Isorhamnetin 3,7-disulfate | Drug Info | [53] | |||
Isorhamnetin 3-O-rhamnoside | Drug Info | [59] | |||
JTT-811 | Drug Info | [60] | |||
KAEMPFEROL | Drug Info | [50] | |||
LIDORESTAT | Drug Info | [61] | |||
M-16209 | Drug Info | [62], [48] | |||
MANGIFERIN | Drug Info | [63] | |||
N-Acetylalanine | Drug Info | [35] | |||
NSC-94258 | Drug Info | [37] | |||
O5-Acetyl-O7-nitrooxyethyl chrysin | Drug Info | [52] | |||
O7-Nitrooxyethyl chrysin | Drug Info | [52] | |||
PALBINONE | Drug Info | [64] | |||
Patuletin 3-O-beta-D-galactoside | Drug Info | [45] | |||
Patuletin 3-O-beta-D-robinobioside | Drug Info | [45] | |||
Ponalrestat | Drug Info | [65] | |||
QR-333 | Drug Info | [66] | |||
Quercetin 3-O-neohesperidoside | Drug Info | [59] | |||
QUERCITRIN | Drug Info | [50] | |||
Ranirestat | Drug Info | [60] | |||
Sorbinil | Drug Info | [67], [68] | |||
SPR-210 | Drug Info | [69] | |||
Sulindac | Drug Info | [70], [71] | |||
Tamarixetin 3-glucoside-7-sulfate | Drug Info | [53] | |||
TINGENIN B | Drug Info | [63] | |||
TINGENONE | Drug Info | [63] | |||
Tolrestat | Drug Info | [72] | |||
TRIPTOCALLINE A | Drug Info | [63] | |||
Zenarestat | Drug Info | [73] | |||
Modulator | BNV-222 | Drug Info | [60] | ||
CTL-102-GDEPT | Drug Info | [74] | |||
E-0722 | Drug Info | [75] | |||
FR-62765 | Drug Info | [27] | |||
MINALRESTAT | Drug Info | ||||
T2c-003 | Drug Info | [60] | |||
WF-2421 | Drug Info | [31] | |||
ZOPOLRESTAT | Drug Info | ||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
BioCyc Pathway | Methylglyoxal degradation III | ||||
Acetone degradation I (to methylglyoxal) | |||||
KEGG Pathway | Pentose and glucuronate interconversions | ||||
Fructose and mannose metabolism | |||||
Galactose metabolism | |||||
Glycerolipid metabolism | |||||
Metabolic pathways | |||||
NetPath Pathway | IL1 Signaling Pathway | ||||
TGF_beta_Receptor Signaling Pathway | |||||
PathWhiz Pathway | Fructose and Mannose Degradation | ||||
Pyruvate Metabolism | |||||
Pterine Biosynthesis | |||||
Glycerolipid Metabolism | |||||
Galactose Metabolism | |||||
WikiPathways | Metapathway biotransformation | ||||
Polyol Pathway | |||||
Metabolism of steroid hormones and vitamin D | |||||
References | |||||
REF 1 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
REF 2 | New drugs in development for the treatment of endometriosis. Expert Opin Investig Drugs. 2008 Aug;17(8):1187-202. | ||||
REF 3 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5425). | ||||
REF 4 | X-ray structure of the V301L aldo-keto reductase 1B10 complexed with NADP(+) and the potent aldose reductase inhibitor fidarestat: implications for inhibitor binding and selectivity. Chem Biol Interact. 2013 Feb 25;202(1-3):178-85. | ||||
REF 5 | ClinicalTrials.gov (NCT00101426) Safety and Efficacy of AS-3201 in the Treatment of Diabetic Sensorimotor Polyneuropathy. U.S. National Institutes of Health. | ||||
REF 6 | ClinicalTrials.gov (NCT00252148) Safety and Immunogenicity of a Modified Vaccinia Ankara (MVA) HIV Vaccine in HIV Uninfected Adults. U.S. National Institutes of Health. | ||||
REF 7 | Phase 1 safety and immunogenicity evaluation of ADMVA, a multigenic, modified vaccinia Ankara-HIV-1 B'/C candidate vaccine. PLoS One. 2010 Jan 25;5(1):e8816. | ||||
REF 8 | ClinicalTrials.gov (NCT00043797) Lidorestat (IDD 676) for the Treatment of Diabetic Neuropathy. U.S. National Institutes of Health. | ||||
REF 9 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7411). | ||||
REF 10 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000031) | ||||
REF 11 | ClinicalTrials.gov (NCT00568035) Safety and Efficacy Study of QR-333 in Patient's With Symptomatic Diabetic Neuropathy. U.S. National Institutes of Health. | ||||
REF 12 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029470) | ||||
REF 13 | Metabolism of the aldose reductase inhibitor ALO1567 in man. Br J Clin Pharmacol. 1991 Aug;32(2):221-7. | ||||
REF 14 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032059) | ||||
REF 15 | Effect of tolrestat, an aldose reductase inhibitor, on neutrophil respiratory burst activity in diabetic patients. Metabolism. 1997 Jun;46(6):634-8. | ||||
REF 16 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7404). | ||||
REF 17 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000020) | ||||
REF 18 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003006) | ||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000017) | ||||
REF 20 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001300) | ||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004143) | ||||
REF 22 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011583) | ||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017463) | ||||
REF 24 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7419). | ||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001173) | ||||
REF 26 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004685) | ||||
REF 27 | Studies on WF-3681, a novel aldose reductase inhibitor. IV. Effect of FR-62765, a derivative of WF-3681, on the diabetic neuropathy in rats. J Antibiot (Tokyo). 1991 Apr;44(4):441-4. | ||||
REF 28 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7415). | ||||
REF 29 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000008) | ||||
REF 30 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002923) | ||||
REF 31 | WF-2421, a new aldose reductase inhibitor produced from a fungus, Humicola grisea. J Antibiot (Tokyo). 1991 Feb;44(2):130-5. | ||||
REF 32 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7418). | ||||
REF 33 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000004) | ||||
REF 34 | J Med Chem. 1986 Oct;29(10):2024-8.Synthesis and aldose reductase inhibitory activity of substituted 2-oxoquinoline-1-acetic acid derivatives. | ||||
REF 35 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 36 | Proc Natl Acad Sci U S A. 2007 Dec 26;104(52):20764-9. Epub 2007 Dec 17.Structural basis for the high all-trans-retinaldehyde reductase activity of the tumor marker AKR1B10. | ||||
REF 37 | J Med Chem. 1999 Jun 3;42(11):1881-93.1-Benzopyran-4-one antioxidants as aldose reductase inhibitors. | ||||
REF 38 | Bioorg Med Chem. 2010 Mar 15;18(6):2107-14. Epub 2010 Feb 11.Design and synthesis of novel series of pyrrole based chemotypes and their evaluation as selective aldose reductase inhibitors. A case ofbioisosterism between a carboxylic acid moiety and that of a tetrazole. | ||||
REF 39 | Bioorg Med Chem. 2008 Apr 1;16(7):3926-32. Epub 2008 Jan 30.Design and synthesis of N-(3,5-difluoro-4-hydroxyphenyl)benzenesulfonamides as aldose reductase inhibitors. | ||||
REF 40 | J Med Chem. 2010 Nov 11;53(21):7756-66.A diverse series of substituted benzenesulfonamides as aldose reductase inhibitors with antioxidant activity: design, synthesis, and in vitro activity. | ||||
REF 41 | Bioorg Med Chem. 2009 Feb 1;17(3):1244-50. Epub 2008 Dec 24.Correlation of binding constants and molecular modelling of inhibitors in the active sites of aldose reductase and aldehyde reductase. | ||||
REF 42 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | ||||
REF 43 | J Med Chem. 1982 Jun;25(6):745-7.Isoxazolidine-3,5-diones as lens aldose reductase inhibitors. | ||||
REF 44 | J Med Chem. 2005 Oct 6;48(20):6326-39.A novel series of non-carboxylic acid, non-hydantoin inhibitors of aldose reductase with potent oral activity in diabetic rat models: 6-(5-chloro-3-methylbenzofuran-2-sulfonyl)-2H-pyridazin-3-one and congeners. | ||||
REF 45 | J Nat Prod. 1984 Mar-Apr;47(2):316-9.Flavonoids with anti-cataract activity from Brickellia arguta. | ||||
REF 46 | Bioorg Med Chem Lett. 2010 Oct 1;20(19):5630-3. Epub 2010 Aug 12.6,7-Dihydroxy-4-phenylcoumarin as inhibitor of aldose reductase 2. | ||||
REF 47 | Studies on antidiabetic agents. IX. A new aldose reductase inhibitor, AD-5467, and related 1,4-benzoxazine and 1,4-benzothiazine derivatives: synthesis and biological activity. Chem Pharm Bull (Tokyo). 1990 May;38(5):1238-45. | ||||
REF 48 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
REF 49 | The Effect of Halogen-to-Hydrogen Bond Substitution on Human Aldose Reductase Inhibition. ACS Chem Biol. 2015 Jul 17;10(7):1637-42. | ||||
REF 50 | J Nat Prod. 2008 Apr;71(4):713-5. Epub 2008 Feb 26.Erigeroflavanone, a flavanone derivative from the flowers of Erigeron annuus with protein glycation and aldose reductase inhibitory activity. | ||||
REF 51 | A selective aldose reductase inhibitor of a new structural class prevents or reverses early retinal abnormalities in experimental diabetic retinopathy. Diabetes. 2006 Oct;55(10):2757-62. | ||||
REF 52 | Bioorg Med Chem. 2010 May 1;18(9):3020-5. Epub 2010 Mar 27.Synthesis, characterization and vasculoprotective effects of nitric oxide-donating derivatives of chrysin. | ||||
REF 53 | J Nat Prod. 1996 Apr;59(4):443-5.Effect of Polygonum hydropiper sulfated flavonoids on lens aldose reductase and related enzymes. | ||||
REF 54 | Long-term effect of epalrestat, an aldose reductase inhibitor, on the development of incipient diabetic nephropathy in Type 2 diabetic patients. J Diabetes Complications. 2001 Sep-Oct;15(5):241-4. | ||||
REF 55 | Clinical investigation of epalrestat, an aldose reductase inhibitor, on diabetic neuropathy in Japan: multicenter study. Diabetic Neuropathy Study Group in Japan. J Diabetes Complications. 1996 May-Jun;10(3):168-72. | ||||
REF 56 | Clinical efficacy of fidarestat, a novel aldose reductase inhibitor, for diabetic peripheral neuropathy: a 52-week multicenter placebo-controlled double-blind parallel group study. Diabetes Care. 2001 Oct;24(10):1776-82. | ||||
REF 57 | Aldose reductase inhibitor SNK-860. Nippon Rinsho. 1997 Nov;55 Suppl:212-5. | ||||
REF 58 | J Med Chem. 1991 Nov;34(11):3229-34.Spiro[fluoreneisothiazolidin]one dioxides: new aldose reductase and L-hexonate dehydrogenase inhibitors. | ||||
REF 59 | J Nat Prod. 2002 Aug;65(8):1151-5.New flavonol oligoglycosides and polyacylated sucroses with inhibitory effects on aldose reductase and platelet aggregation from the flowers of Prunus mume. | ||||
REF 60 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2768). | ||||
REF 61 | J Med Chem. 2005 May 5;48(9):3141-52.Discovery of 3-[(4,5,7-trifluorobenzothiazol-2-yl)methyl]indole-N-acetic acid (lidorestat) and congeners as highly potent and selective inhibitors of aldose reductase for treatment of chronic diabetic complications. | ||||
REF 62 | Effects of novel aldose reductase inhibitors, M16209 and M16287, on streptozotocin-induced diabetic neuropathy in rats. Eur J Pharmacol. 1991 Feb 7;193(2):185-91. | ||||
REF 63 | J Nat Prod. 2003 Sep;66(9):1191-6.Structures of new friedelane-type triterpenes and eudesmane-type sesquiterpene and aldose reductase inhibitors from Salacia chinensis. | ||||
REF 64 | J Nat Prod. 2009 Aug;72(8):1465-70.Inhibitors of aldose reductase and formation of advanced glycation end-products in moutan cortex (Paeonia suffruticosa). | ||||
REF 65 | Ponalrestat, an aldose reductase inhibitor, inhibits cachexia syndrome induced by colon26 adenocarcinoma in mice. Anticancer Res. 1999 Sep-Oct;19(5B):4105-11. | ||||
REF 66 | A multicenter, double-blind, safety study of QR-333 for the treatment of symptomatic diabetic peripheral neuropathy. A preliminary report. J Diabetes Complications. 2005 Sep-Oct;19(5):247-53. | ||||
REF 67 | Recent clinical experience with aldose reductase inhibitors. J Diabetes Complications. 1992 Jan-Mar;6(1):39-44. | ||||
REF 68 | A controlled trial of sorbinil, an aldose reductase inhibitor, in chronic painful diabetic neuropathy. Diabetes. 1983 Oct;32(10):938-42. | ||||
REF 69 | Pharmacological profiles of a novel aldose reductase inhibitor, SPR-210, and its effects on streptozotocin-induced diabetic rats. Jpn J Pharmacol. 1994 Feb;64(2):115-24. | ||||
REF 70 | Inhibition of human lens aldose reductase by flavonoids, sulindac and indomethacin. Biochem Pharmacol. 1983 Jul 1;32(13):1995-8. | ||||
REF 71 | Diabetic complications in lens and nerve and their prevention by sulindac or sorbinil: two novel aldose reductase inhibitors. Invest Ophthalmol Vis Sci. 1983 Oct;24(10):1426-9. | ||||
REF 72 | Aldose reductase inhibitors: an update. Ann Pharmacother. 1993 Jun;27(6):751-4. | ||||
REF 73 | The effects of zenarestat, an aldose reductase inhibitor, on minimal F-wave latency and nerve blood flow in streptozotocin-induced diabetic rats. Life Sci. 2001 Feb 9;68(12):1439-48. | ||||
REF 74 | Genes in the Service of Therapeutic Index: Progress for Virus-Directed Enzyme Prodrug Therapy. JCO May 1, 2004 vol. 22 no. 9 1535-1537c. | ||||
REF 75 | Aldose reductase inhibitors and prevention of galactose cataracts in rats. Invest Ophthalmol Vis Sci. 1989 Jul;30(7):1623-32. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.