Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T80896
|
||||
Former ID |
TTDS00250
|
||||
Target Name |
Estrogen receptor beta
|
||||
Gene Name |
ESR2
|
||||
Synonyms |
Beta-1; ER-beta; Erbeta; Oestrogen receptor beta; ESR2
|
||||
Target Type |
Successful
|
||||
Disease | Breast cancer [ICD9: 174, 175; ICD10: C50] | ||||
Carcinoma [ICD9: 230-234; ICD10: D00-D09] | |||||
Cushing's disease [ICD9: 255; ICD10: E24.0] | |||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Estrogen deficiency [ICD10: E28.39] | |||||
Hot flashes [ICD10: N95.1] | |||||
Hyperlipidaemia [ICD9: 272.0-272.4; ICD10: E78] | |||||
Hepatitis virus infection [ICD9: 573.3; ICD10: K75.9] | |||||
Irregularities [ICD10: N92.6] | |||||
Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51] | |||||
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
Menopause symptoms [ICD10: N95.0] | |||||
Ocular disease [ICD10: H00-H59] | |||||
Prostate cancer [ICD9: 185; ICD10: C61] | |||||
Prostate hyperplasia [ICD10: N40] | |||||
Sepsis [ICD9: 995.91; ICD10: A40, A41] | |||||
Trematode infection [ICD10: B66.9] | |||||
Vasomotor symptoms [ICD9: 627.2; ICD10: N95.1] | |||||
Function |
Nuclear hormone receptor. binds estrogens with an affinity similar to that of esr1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. Isoform beta-cx lacks ligand binding ability.
|
||||
BioChemical Class |
Nuclear hormone receptor
|
||||
Target Validation |
T80896
|
||||
UniProt ID | |||||
Sequence |
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS
NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ |
||||
Drugs and Mode of Action | |||||
Drug(s) | ARZOXIFENE | Drug Info | Approved | Breast cancer | [1], [2] |
Conjugated Estrogens | Drug Info | Approved | Vasomotor symptoms | [3], [4] | |
Estrogen | Drug Info | Approved | Menopause symptoms | [5] | |
Premarin | Drug Info | Approved | Menopause | [6] | |
Trilostane | Drug Info | Approved | Cushing's disease | [7], [8] | |
MF-101 | Drug Info | Phase 3 | Hepatitis virus infection | [9] | |
Premarin/Pravachol | Drug Info | Phase 3 | Hyperlipidaemia | [10] | |
AUS-131 | Drug Info | Phase 2 | Hot flashes | [11] | |
ERB-041 | Drug Info | Phase 2 | Inflammatory bowel disease | [12], [13] | |
Erteberel | Drug Info | Phase 2 | Prostate hyperplasia | [14] | |
Genistein | Drug Info | Phase 2 | Prostate cancer | [15], [16] | |
VG-101 | Drug Info | Phase 1/2 | Menopause symptoms | [17] | |
ERB-257 | Drug Info | Phase 1 | Sepsis | [18] | |
NARINGENIN | Drug Info | Phase 1 | Discovery agent | [19] | |
BITHIONOL | Drug Info | Withdrawn from market | Trematode infection | [20], [5] | |
HEXESTROL | Drug Info | Withdrawn from market | Irregularities | [21], [22], [23] | |
EM-800 | Drug Info | Discontinued in Phase 3 | Estrogen deficiency | [24] | |
ERB-196 | Drug Info | Discontinued in Phase 1 | Inflammatory bowel disease | [25] | |
ICI-164384 | Drug Info | Terminated | Breast cancer | [26] | |
LY-117018 | Drug Info | Terminated | Discovery agent | [27] | |
ZK-119010 | Drug Info | Terminated | Carcinoma | [28] | |
Inhibitor | 1,2-Bis-(4-hydroxy-phenyl)-3H-inden-5-ol | Drug Info | [29] | ||
1,8-Dichloro-6-(4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
1-Bromo-6-(4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
1-Chloro-6-(4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
1-CHLORO-6-(4-HYDROXYPHENYL)-2-NAPHTHOL | Drug Info | [31] | |||
1-Fluoro-6-(4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
2,3-diphenyl-1H-indole | Drug Info | [32] | |||
2-(2-Chloro-4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [33] | |||
2-(3-Butoxy-4-hydroxy-phenyl)-benzooxazol-6-ol | Drug Info | [33] | |||
2-(3-Chloro-4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [33] | |||
2-(3-Chloro-4-hydroxy-phenyl)-benzooxazol-6-ol | Drug Info | [33] | |||
2-(3-Fluoro-4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [33] | |||
2-(3-Fluoro-4-hydroxy-phenyl)-benzooxazol-6-ol | Drug Info | [33] | |||
2-(3-hydroxyphenyl)-1,2'-spirobi[1H-indene]-5-ol | Drug Info | [34] | |||
2-(3-hydroxyphenyl)-1,2'-spirobi[1H-indene]-6-ol | Drug Info | [34] | |||
2-(4-Hydroxy-naphthalen-1-yl)-benzooxazol-6-ol | Drug Info | [33] | |||
2-(4-Hydroxy-phenyl)-1-p-tolyl-3H-inden-5-ol | Drug Info | [29] | |||
2-(4-Hydroxy-phenyl)-4-methoxy-quinolin-6-ol | Drug Info | [35] | |||
2-(4-Hydroxy-phenyl)-4-vinyl-quinolin-6-ol | Drug Info | [35] | |||
2-(4-Hydroxy-phenyl)-7-isopropyl-benzooxazol-5-ol | Drug Info | [33] | |||
2-(4-Hydroxy-phenyl)-7-methoxy-benzofuran-5-ol | Drug Info | [36] | |||
2-(4-Hydroxy-phenyl)-7-methoxy-benzooxazol-5-ol | Drug Info | [33] | |||
2-(4-Hydroxy-phenyl)-7-methyl-benzofuran-5-ol | Drug Info | [36] | |||
2-(4-Hydroxy-phenyl)-7-phenyl-benzooxazol-5-ol | Drug Info | [33] | |||
2-(4-Hydroxy-phenyl)-7-propenyl-benzooxazol-5-ol | Drug Info | [33] | |||
2-(4-Hydroxy-phenyl)-7-propyl-benzooxazol-5-ol | Drug Info | [33] | |||
2-(4-Hydroxy-phenyl)-7-vinyl-benzooxazol-5-ol | Drug Info | [33] | |||
2-(4-Hydroxy-phenyl)-benzofuran-5-ol | Drug Info | [33] | |||
2-(4-Hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [33] | |||
2-(4-Hydroxy-phenyl)-benzooxazol-6-ol | Drug Info | [33] | |||
2-(4-Hydroxy-phenyl)-quinolin-6-ol | Drug Info | [35] | |||
2-(4-HYDROXY-PHENYL)BENZOFURAN-5-OL | Drug Info | [31] | |||
2-(4-hydroxyphenyl)-1,2'-spirobi[1H-indene]-5-ol | Drug Info | [34] | |||
2-(5-Hydroxy-naphthalen-1-yl)-benzooxazol-6-ol | Drug Info | [33] | |||
2-(6-Hydroxy-naphthalen-1-yl)-benzooxazol-5-ol | Drug Info | [33] | |||
2-(6-Hydroxy-naphthalen-1-yl)-benzooxazol-6-ol | Drug Info | [33] | |||
2-(6-Hydroxy-naphthalen-2-yl)-benzooxazol-5-ol | Drug Info | [33] | |||
2-(6-Hydroxy-naphthalen-2-yl)-benzooxazol-6-ol | Drug Info | [33] | |||
2-Naphthalen-1-yl-benzooxazol-6-ol | Drug Info | [33] | |||
2-phenyl-1,2'-spirobi[1H-indene]-5'-ol | Drug Info | [34] | |||
3'-Methoxy-4'Hydroxyclomiphene | Drug Info | [37] | |||
3,4,6-Trihydroxy-2-(4-hydroxy-phenyl)-inden-1-one | Drug Info | [38] | |||
3,6-Dihydroxy-2-(4-hydroxy-phenyl)-inden-1-one | Drug Info | [38] | |||
3,8-dihydroxy-4-methyl-6H-benzo[c]chromen-6-one | Drug Info | [39] | |||
3,8-dihydroxy-7-methyl-6H-benzo[c]chromen-6-one | Drug Info | [39] | |||
3-(2-Hydroxy-phenyl)-benzo[d]isoxazol-6-ol | Drug Info | [33] | |||
3-(4-Hydroxy-phenyl)-4H-chromen-7-ol | Drug Info | [40] | |||
3-(4-Hydroxy-phenyl)-benzo[d]isoxazol-5-ol | Drug Info | [33] | |||
3-(4-Hydroxy-phenyl)-benzo[d]isoxazol-6-ol | Drug Info | [33] | |||
3-(5-Hydroxy-benzooxazol-2-yl)-benzene-1,2-diol | Drug Info | [33] | |||
3-(6-Hydroxy-benzooxazol-2-yl)-benzene-1,2-diol | Drug Info | [33] | |||
3-chloro-4-(4-hydroxyphenyl)salicylaldoxime | Drug Info | [41] | |||
3-hydroxy-4,10-dimethyl-6H-benzo[c]chromen-6-one | Drug Info | [39] | |||
3-hydroxy-4,7-dimethyl-6H-benzo[c]chromen-6-one | Drug Info | [39] | |||
3-hydroxy-4-methyl-6H-benzo[c]chromen-6-one | Drug Info | [39] | |||
3-hydroxy-8,10-dimethyl-6H-benzo[c]chromen-6-one | Drug Info | [39] | |||
3-[1-ethyl-2-(3-hydroxyphenyl)butyl]phenol | Drug Info | [42] | |||
4',5,7-trihydroxy-6,8-dimethylisoflavone | Drug Info | [43] | |||
4,10-dimethyl-6H-benzo[c]chromene-3,8-diol | Drug Info | [39] | |||
4,6,10-trimethyl-6H-benzo[c]chromene-3,8-diol | Drug Info | [39] | |||
4,6,6,7-tetramethyl-6H-benzo[c]chromene-3,8-diol | Drug Info | [39] | |||
4,6,7,10-tetramethyl-6H-benzo[c]chromene-3,8-diol | Drug Info | [39] | |||
4,6,7-trimethyl-6H-benzo[c]chromene-3,8-diol | Drug Info | [39] | |||
4,7-dimethyl-6H-benzo[c]chromene-3,8-diol | Drug Info | [39] | |||
4-(2-phenyl-1H-benzo[d]imidazol-1-yl)phenol | Drug Info | [32] | |||
4-(2-phenyl-1H-indol-3-yl)phenol | Drug Info | [32] | |||
4-(3-(4-hydroxyphenyl)-1H-indol-2-yl)phenol | Drug Info | [32] | |||
4-(3-phenyl-1H-indol-2-yl)phenol | Drug Info | [32] | |||
4-(4-HYDROXYPHENYL)-1-NAPHTHALDEHYDE OXIME | Drug Info | [31] | |||
4-(5-Hydroxy-benzooxazol-2-yl)-benzene-1,3-diol | Drug Info | [33] | |||
4-(6-Hydroxy-benzooxazol-2-yl)-benzene-1,2-diol | Drug Info | [33] | |||
4-(6-Hydroxy-benzooxazol-2-yl)-benzene-1,3-diol | Drug Info | [33] | |||
4-Benzo[d]isoxazol-3-yl-benzene-1,3-diol | Drug Info | [33] | |||
4-Bromo-2-(4-hydroxy-phenyl)-quinolin-6-ol | Drug Info | [35] | |||
4-Chloro-2-(4-hydroxy-phenyl)-quinolin-6-ol | Drug Info | [35] | |||
4-Ethyl-2-(4-hydroxy-phenyl)-quinolin-6-ol | Drug Info | [35] | |||
4-Ethynyl-2-(4-hydroxy-phenyl)-quinolin-6-ol | Drug Info | [35] | |||
4-Naphthalen-2-yl-phenol | Drug Info | [30] | |||
4-[1,2-bis(4-hydroxyphenyl)but-1-enyl]phenol | Drug Info | [44] | |||
4-[1,2-bis(4-hydroxyphenyl)hex-1-enyl]phenol | Drug Info | [44] | |||
4-[1,2-bis(4-hydroxyphenyl)pent-1-enyl]phenol | Drug Info | [44] | |||
4-[1,2-bis(4-hydroxyphenyl)vinyl]phenol | Drug Info | [44] | |||
4-[2,2-bis(4-hydroxyphenyl)-1-methylvinyl]phenol | Drug Info | [44] | |||
5,7-dihydroxy-3-phenyl-3H-quinazolin-4-one | Drug Info | [45] | |||
5-Bromo-2-(4-hydroxy-phenyl)-quinolin-6-ol | Drug Info | [35] | |||
5-Chloro-2-(4-hydroxy-phenyl)-benzooxazol-6-ol | Drug Info | [33] | |||
5-Chloro-2-(4-hydroxy-phenyl)-quinolin-6-ol | Drug Info | [35] | |||
6-(2,5-Difluoro-4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
6-(2,6-Difluoro-4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
6-(2-Chloro-4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
6-(2-Fluoro-4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
6-(2-Hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
6-(3,5-Difluoro-4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
6-(3-Chloro-4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
6-(3-Fluoro-4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
6-(3-Hydroxy-phenyl)-naphthalen-1-ol | Drug Info | [30] | |||
6-(3-Hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
6-(4-Hydroxy-2-methoxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
6-(4-Hydroxy-2-methyl-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
6-(4-Hydroxy-phenyl)-1-methoxy-naphthalen-2-ol | Drug Info | [30] | |||
6-(4-Hydroxy-phenyl)-1-methyl-naphthalen-2-ol | Drug Info | [30] | |||
6-(4-Hydroxy-phenyl)-1-nitro-naphthalen-2-ol | Drug Info | [30] | |||
6-(4-Hydroxy-phenyl)-1-phenyl-naphthalen-2-ol | Drug Info | [30] | |||
6-(4-Hydroxy-phenyl)-naphthalen-1-ol | Drug Info | [30] | |||
6-(4-Hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [35] | |||
6-Chloro-2-(4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [33] | |||
6-ethyl-4,7-dimethyl-6H-benzo[c]chromene-3,8-diol | Drug Info | [39] | |||
6-Phenyl-naphthalen-2-ol | Drug Info | [30] | |||
7-(3-Hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
7-(4-Hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
7-Allyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [33] | |||
7-Bromo-2-(4-hydroxy-phenyl)-benzofuran-5-ol | Drug Info | [36] | |||
7-Bromo-2-(4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [33] | |||
7-Butyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [33] | |||
7-Chloro-2-(4-hydroxy-phenyl)-benzofuran-5-ol | Drug Info | [36] | |||
7-Ethyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [33] | |||
7-Ethynyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol | Drug Info | [33] | |||
7-hydroxy-1,2,9,9a-tetrahydrofluoren-3-one | Drug Info | [46] | |||
7-hydroxy-3-(4-hydroxyphenyl)-3H-quinazolin-4-one | Drug Info | [45] | |||
7-Phenyl-naphthalen-2-ol | Drug Info | [30] | |||
8-(2,2-dimethylpropyl)naringenin | Drug Info | [47] | |||
8-(2-methylpropyl)naringenin | Drug Info | [47] | |||
8-(3-methylbutyl)naringenin | Drug Info | [47] | |||
8-benzylnaringenin | Drug Info | [47] | |||
8-Chloro-6-(4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
8-Fluoro-6-(4-hydroxy-phenyl)-naphthalen-2-ol | Drug Info | [30] | |||
8-methylnaringenin | Drug Info | [47] | |||
8-n-heptylnaringenin | Drug Info | [47] | |||
8-n-nonylnaringenin | Drug Info | [47] | |||
8-n-pentylnaringenin | Drug Info | [47] | |||
8-n-propylnaringenin | Drug Info | [47] | |||
8-n-undecylnaringenin | Drug Info | [47] | |||
Acetate Ion | Drug Info | [48] | |||
ANDROSTENEDIOL | Drug Info | [49] | |||
ARZOXIFENE | Drug Info | [50] | |||
BITHIONOL | Drug Info | [51] | |||
BROUSSONIN A | Drug Info | [52] | |||
COUMESTROL | Drug Info | [40] | |||
CP-394531 | Drug Info | [53] | |||
CP-409069 | Drug Info | [53] | |||
DIADZEIN | Drug Info | [43] | |||
DIHYDRORALOXIFENE | Drug Info | [54] | |||
Doxorubicin-Formaldehyde Conjugate | Drug Info | [55] | |||
EFFUSOL | Drug Info | [39] | |||
Estrogen platinum(II) hybrid derivative | Drug Info | [56] | |||
Geldanamycin-estradiol hybrid | Drug Info | [57] | |||
GNF-PF-3037 | Drug Info | [51] | |||
HEXESTROL | Drug Info | [58] | |||
ICI-164384 | Drug Info | [59] | |||
LY-117018 | Drug Info | [60] | |||
MORIN | Drug Info | [51] | |||
NAFOXIDINE | Drug Info | [61] | |||
NARINGENIN | Drug Info | [47] | |||
Para-Mercury-Benzenesulfonic Acid | Drug Info | [48] | |||
Pipendoxifene | Drug Info | [62] | |||
SOPHORAFLAVANONE B | Drug Info | [47] | |||
THIOGENISTEIN | Drug Info | [45] | |||
TUPICHINOL C | Drug Info | [52] | |||
WAY-169916 | Drug Info | [63] | |||
ZK-119010 | Drug Info | [64] | |||
ZK-164015 | Drug Info | [65] | |||
[1,1':2',1'']Terphenyl-4'-carbaldehyde oxime | Drug Info | [66] | |||
Agonist | AUS-131 | Drug Info | [67] | ||
bisphenol A | Drug Info | [68] | |||
diarylpropionitril | Drug Info | [69] | |||
ERB-002 | Drug Info | [70] | |||
ERB-041 | Drug Info | [71], [5] | |||
ERB-196 | Drug Info | [72] | |||
ERB-257 | Drug Info | [73] | |||
Erteberel | Drug Info | [74] | |||
Estrogen | Drug Info | [75] | |||
GTx-878 | Drug Info | [70] | |||
KB-9520 | Drug Info | [70] | |||
NDC-1022 | Drug Info | [70] | |||
VG-101 | Drug Info | [76] | |||
WAY200070 | Drug Info | [33] | |||
Antagonist | Conjugated Estrogens | Drug Info | [77], [78] | ||
EM-800 | Drug Info | [79] | |||
HPTE | Drug Info | [80] | |||
MF-101 | Drug Info | [81] | |||
PHTPP | Drug Info | [82] | |||
Premarin | Drug Info | [77], [78] | |||
R,R-THC | Drug Info | [83] | |||
Trans-hydroxytamoxifen | Drug Info | [84] | |||
Modulator | Estrogen receptor beta modulators | Drug Info | [70] | ||
Genistein | Drug Info | ||||
GTx-822 | Drug Info | [70] | |||
Premarin/Pravachol | Drug Info | [10] | |||
Trilostane | Drug Info | [85] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Estrogen signaling pathway | ||||
Prolactin signaling pathway | |||||
Pathway Interaction Database | Plasma membrane estrogen receptor signaling | ||||
Validated nuclear estrogen receptor beta network | |||||
Validated nuclear estrogen receptor alpha network | |||||
Reactome | Nuclear Receptor transcription pathway | ||||
WikiPathways | SIDS Susceptibility Pathways | ||||
Ovarian Infertility Genes | |||||
Integrated Pancreatic Cancer Pathway | |||||
Nuclear Receptors | |||||
References | |||||
REF 1 | ClinicalTrials.gov (NCT00190697) A Study of LY353381 (Arzoxifene) for Patients Who Benefitted From This Drug in Other Oncology Trials and Wished to Continue Treatment. U.S. National Institutes of Health. | ||||
REF 2 | Clinical pipeline report, company report or official report of Lilly. | ||||
REF 3 | Roles of hormone replacement therapy and iron in proliferation of breast epithelial cells with different estrogen and progesterone receptor status. Breast. 2008 Apr;17(2):172-9. Epub 2007 Oct 24. | ||||
REF 4 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
REF 5 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
REF 6 | ClinicalTrials.gov (NCT01613170) Premarin Versus Toviaz for Treatment of Overactive Bladder. U.S. National Institutes of Health. | ||||
REF 7 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 018719. | ||||
REF 8 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6850). | ||||
REF 9 | ClinicalTrials.gov (NCT00906308) A Study of MF101 in Postmenopausal Women. U.S. National Institutes of Health. | ||||
REF 10 | Lovastatin and beyond: the history of the HMG-CoA reductase inhibitors. Nat Rev Drug Discov. 2003 Jul;2(7):517-26. | ||||
REF 11 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030256) | ||||
REF 12 | ClinicalTrials.gov (NCT00318500) Study Evaluating the Safety and Efficacy of ERB-041 on Reduction of Symptoms Associated With Endometriosis in Reproductive-Aged Women. U.S. National Institutes of Health. | ||||
REF 13 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6700). | ||||
REF 14 | ClinicalTrials.gov (NCT01874756) The Efficacy and Safety of a Selective Estrogen Receptor Beta Agonist (LY500307) for Negative Symptoms and Cognitive Impairment Associated With Schizophrenia. U.S. National Institutes of Health. | ||||
REF 15 | New drugs in development for the treatment of endometriosis. Expert Opin Investig Drugs. 2008 Aug;17(8):1187-202. | ||||
REF 16 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2826). | ||||
REF 17 | ClinicalTrials.gov (NCT00453089) VG101 Phase I/II to Treat Vulvar and Vaginal Atrophy in Post-Menopausal Women. U.S. National Institutes of Health. | ||||
REF 18 | ClinicalTrials.gov (NCT00722202) Study Evaluating the Safety and Pharmacokinetics (PK) of Ascending Single IV Doses of ERB-257 in Healthy Japanese Males. U.S. National Institutes of Health. | ||||
REF 19 | ClinicalTrials.gov (NCT01091077) A Pilot Study of the Grapefruit Flavonoid Naringenin for HCV Infection. U.S. National Institutes of Health. | ||||
REF 20 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2338). | ||||
REF 21 | Carcinogenicity and metabolic activation of hexestrol. Chem Biol Interact. 1985 Oct;55(1-2):157-76. | ||||
REF 22 | Comparison of the ligand binding specificity and transcript tissue distribution of estrogen receptors alpha and beta. Endocrinology. 1997 Mar;138(3):863-70. | ||||
REF 23 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2823). | ||||
REF 24 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009862) | ||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021229) | ||||
REF 26 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000792) | ||||
REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000893) | ||||
REF 28 | Pharmacological characterization of a novel oestrogen antagonist, ZK 119010, in rats and mice. J Endocrinol. 1991 Sep;130(3):409-14. | ||||
REF 29 | J Med Chem. 2005 Sep 22;48(19):5989-6003.Differential response of estrogen receptor subtypes to 1,3-diarylindene and 2,3-diarylindene ligands. | ||||
REF 30 | J Med Chem. 2005 Jun 16;48(12):3953-79.ERbeta ligands. 3. Exploiting two binding orientations of the 2-phenylnaphthalene scaffold to achieve ERbeta selectivity. | ||||
REF 31 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | ||||
REF 32 | Bioorg Med Chem Lett. 2005 Dec 15;15(24):5562-6. Epub 2005 Oct 10.Estrogen receptor beta selective ligands: discovery and SAR of novel heterocyclic ligands. | ||||
REF 33 | J Med Chem. 2004 Oct 7;47(21):5021-40.Design and synthesis of aryl diphenolic azoles as potent and selective estrogen receptor-beta ligands. | ||||
REF 34 | Bioorg Med Chem Lett. 2003 Feb 10;13(3):479-83.2-Phenylspiroindenes: a novel class of selective estrogen receptor modulators (SERMs). | ||||
REF 35 | Bioorg Med Chem Lett. 2005 Oct 15;15(20):4520-5.ERbeta ligands. Part 4: Synthesis and structure-activity relationships of a series of 2-phenylquinoline derivatives. | ||||
REF 36 | Bioorg Med Chem Lett. 2004 Oct 4;14(19):4925-9.7-Substituted 2-phenyl-benzofurans as ER beta selective ligands. | ||||
REF 37 | J Med Chem. 1989 Jan;32(1):192-7.Phenolic metabolites of clomiphene: [(E,Z)-2-[4-(1,2-diphenyl-2-chlorovinyl)phenoxy]ethyl]diethylamine. Preparation, electrophilicity, and effects in MCF 7 breast cancer cells. | ||||
REF 38 | Bioorg Med Chem Lett. 2005 Jun 15;15(12):3137-42.Estrogen receptor ligands: design and synthesis of new 2-arylindene-1-ones. | ||||
REF 39 | Bioorg Med Chem Lett. 2006 Mar 15;16(6):1468-72. Epub 2006 Jan 18.6H-Benzo[c]chromen-6-one derivatives as selective ERbeta agonists. | ||||
REF 40 | J Med Chem. 2005 May 19;48(10):3463-6.Structure-based virtual screening for plant-based ERbeta-selective ligands as potential preventative therapy against age-related neurodegenerative diseases. | ||||
REF 41 | J Med Chem. 2008 Mar 13;51(5):1344-51. Epub 2008 Feb 13.Monoaryl-substituted salicylaldoximes as ligands for estrogen receptor beta. | ||||
REF 42 | J Med Chem. 1986 Sep;29(9):1668-74.Influence of alkyl chain ramification on estradiol receptor binding affinity and intrinsic activity of 1,2-dialkylated 1,2-bis(4- or 3-hydroxyphenyl)ethane estrogens and antiestrogens. | ||||
REF 43 | J Nat Prod. 2002 Dec;65(12):1749-53.Isolation and structure elucidation of an isoflavone and a sesterterpenoic acid from Henriettella fascicularis. | ||||
REF 44 | J Med Chem. 2003 Apr 10;46(8):1484-91.Antiestrogenically active 1,1,2-tris(4-hydroxyphenyl)alkenes without basic side chain: synthesis and biological activity. | ||||
REF 45 | J Med Chem. 2006 Apr 20;49(8):2440-55.Synthesis and characterization of 3-arylquinazolinone and 3-arylquinazolinethione derivatives as selective estrogen receptor beta modulators. | ||||
REF 46 | Bioorg Med Chem Lett. 2006 Jul 1;16(13):3489-94. Epub 2006 May 2.The discovery of tetrahydrofluorenones as a new class of estrogen receptor beta-subtype selective ligands. | ||||
REF 47 | J Med Chem. 2006 Dec 14;49(25):7357-65.Subtle side-chain modifications of the hop phytoestrogen 8-prenylnaringenin result in distinct agonist/antagonist activity profiles for estrogen receptors alphaand beta. | ||||
REF 48 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 49 | Bioorg Med Chem Lett. 2007 Nov 15;17(22):6295-8. Epub 2007 Sep 7.Androstene-3,5-dienes as ER-beta selective SERMs. | ||||
REF 50 | J Med Chem. 2007 May 31;50(11):2682-92. Epub 2007 May 10.Benzothiophene selective estrogen receptor modulators with modulated oxidative activity and receptor affinity. | ||||
REF 51 | Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. Epub 2010 Oct 21.In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). | ||||
REF 52 | Bioorg Med Chem Lett. 2010 Jun 15;20(12):3764-7. Epub 2010 Apr 19.New estrogenic compounds isolated from Broussonetia kazinoki. | ||||
REF 53 | J Med Chem. 2002 Jun 6;45(12):2417-24.Discovery of potent, nonsteroidal, and highly selective glucocorticoid receptor antagonists. | ||||
REF 54 | Bioorg Med Chem Lett. 1999 Apr 19;9(8):1137-40.Synthesis and biological activity of trans-2,3-dihydroraloxifene. | ||||
REF 55 | J Med Chem. 2004 Feb 26;47(5):1193-206.Design, synthesis, and biological evaluation of doxorubicin-formaldehyde conjugates targeted to breast cancer cells. | ||||
REF 56 | Bioorg Med Chem Lett. 2004 Dec 6;14(23):5919-24.Biological evaluation of novel estrogen-platinum(II) hybrid molecules on uterine and ovarian cancers-molecular modeling studies. | ||||
REF 57 | Bioorg Med Chem Lett. 1999 May 3;9(9):1233-8.Synthesis and evaluation of geldanamycin-estradiol hybrids. | ||||
REF 58 | Bone targeted drugs 2. synthesis of estrogens with hydroxyapatite affinity, Bioorg. Med. Chem. Lett. 6(9):1047-1050 (1996). | ||||
REF 59 | J Med Chem. 1991 May;34(5):1624-30.Synthesis and biological activity of new halo-steroidal antiestrogens. | ||||
REF 60 | J Med Chem. 1990 Dec;33(12):3222-9.Structure-activity relationship of antiestrogens. Phenolic analogues of 2,3-diaryl-2H-1-benzopyrans. | ||||
REF 61 | J Med Chem. 1998 Jul 30;41(16):2928-31.Discovery and preclinical pharmacology of a novel, potent, nonsteroidal estrogen receptor agonist/antagonist, CP-336156, a diaryltetrahydronaphthalene. | ||||
REF 62 | J Med Chem. 2001 May 24;44(11):1654-7.Design, synthesis, and preclinical characterization of novel, highly selective indole estrogens. | ||||
REF 63 | J Med Chem. 2004 Dec 16;47(26):6435-8.Synthesis and activity of substituted 4-(indazol-3-yl)phenols as pathway-selective estrogen receptor ligands useful in the treatment of rheumatoid arthritis. | ||||
REF 64 | J Med Chem. 1991 Jul;34(7):2145-52.2-Phenylindole-linked [2-(aminoalkyl)pyridine]dichloroplatinum(II): complexes with a selective action on estrogen receptor positive mammary tumors. | ||||
REF 65 | Bioorg Med Chem Lett. 2004 Sep 20;14(18):4659-63.Synthesis and biological evaluation of stilbene-based pure estrogen antagonists. | ||||
REF 66 | J Med Chem. 2003 Sep 11;46(19):4032-42.Novel estrogen receptor ligands based on an anthranylaldoxime structure: role of the phenol-type pseudocycle in the binding process. | ||||
REF 67 | S-equol, a potent ligand for estrogen receptor beta, is the exclusive enantiomeric form of the soy isoflavone metabolite produced by human intestinal bacterial flora. Am J Clin Nutr. 2005 May;81(5):1072-9. | ||||
REF 68 | Structure-activity relationships of bisphenol A analogs at estrogen receptors (ERs): discovery of an ERalpha-selective antagonist. Bioorg Med Chem Lett. 2013 Jul 15;23(14):4031-6. | ||||
REF 69 | Estrogen receptor-beta potency-selective ligands: structure-activity relationship studies of diarylpropionitriles and their acetylene and polar analogues. J Med Chem. 2001 Nov 22;44(24):4230-51. | ||||
REF 70 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 621). | ||||
REF 71 | Erb-041, an estrogen receptor-beta agonist, inhibits skin photocarcinogenesis in SKH-1 hairless mice by downregulating the WNT signaling pathway. Cancer Prev Res (Phila). 2014 Feb;7(2):186-98. | ||||
REF 72 | WAY-202196, a selective estrogen receptor-beta agonist, protects against death in experimental septic shock. Crit Care Med. 2006 Aug;34(8):2188-93. | ||||
REF 73 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030075) | ||||
REF 74 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031986) | ||||
REF 75 | Estrogen inhibits the vascular injury response in estrogen receptor beta-deficient female mice. Proc Natl Acad Sci U S A. 1999 Dec 21;96(26):15133-6. | ||||
REF 76 | Update on alternative therapies for vulvovaginal atrophy. Patient Prefer Adherence. 2011; 5: 533-536. | ||||
REF 77 | Knockouts model the 100 best-selling drugs--will they model the next 100? Nat Rev Drug Discov. 2003 Jan;2(1):38-51. | ||||
REF 78 | Differential biochemical and cellular actions of Premarin estrogens: distinct pharmacology of bazedoxifene-conjugated estrogens combination. Mol Endocrinol. 2009 Jan;23(1):74-85. Epub 2008 Nov 26. | ||||
REF 79 | EM-800, a novel antiestrogen, acts as a pure antagonist of the transcriptional functions of estrogen receptors alpha and beta. Endocrinology. 1998 Jan;139(1):111-8. | ||||
REF 80 | Signalling by CXC-chemokine receptors 1 and 2 expressed in CHO cells: a comparison of calcium mobilization, inhibition of adenylyl cyclase and stimulation of GTPgammaS binding induced by IL-8 and GROalpha. Br J Pharmacol. 1999 Feb;126(3):810-8. | ||||
REF 81 | MF101, a selective estrogen receptor beta modulator for the treatment of menopausal hot flushes: a phase II clinical trial. Menopause. 2009 May-Jun;16(3):458-65. | ||||
REF 82 | Structure-guided optimization of estrogen receptor binding affinity and antagonist potency of pyrazolopyrimidines with basic side chains. J Med Chem. 2007 Jan 25;50(2):399-403. | ||||
REF 83 | Estrogen receptor subtype-selective ligands: asymmetric synthesis and biological evaluation of cis- and trans-5,11-dialkyl- 5,6,11, 12-tetrahydrochrysenes. J Med Chem. 1999 Jul 1;42(13):2456-68. | ||||
REF 84 | Antagonists selective for estrogen receptor alpha. Endocrinology. 2002 Mar;143(3):941-7. | ||||
REF 85 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.