Target Regulator(s) Information (Transcription Factor)

Content Navigation (  All   None )                                      
Target General Information
The Transcription Factors (TFs) Regulating This Target
References
Target General Information  Top
Target ID T12475 Target Info
Target Name Gonadotropin-releasing hormone receptor (GNRHR)
Synonyms Hypothalamic gonadotropin-releasing hormone receptor; Gonadotrophin releasing hormone receptor; GnRH-R; GnRH receptor; GRHR
Target Type Successful Target
Gene Name GNRHR
Biochemical Class GPCR rhodopsin
UniProt ID
GNRHR_HUMAN
The Transcription Factors (TFs) Regulating This Target  Top
TF Name c-Jun/c-Fos (AP-1) heterodimer
Classification Superclass Basic Domains
Class Leucine zipper factors (bZIP)
Family AP-1(-like) components
Regulation Type Increase
Regulation Mechanism Gel mobility assays confirmed the binding of POU2F1, CREB, GATA-2, GATA-3,AP-1 from JEG-3 cells to the four putative transcription factor-binding sites of the upstream placenta-specific promoter for GNRHR. [1]
Evidence Score (E-score) 2 +
1 Electrophoretic Mobility Shift Assay [2]
2 Reporter Assay, Electrophoretic Mobility Shift Assay [1]
UniProt ID
JUN_HUMAN/FOS_HUMAN
Sequence
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Acyltransferases [+] 1 Acyltransferases Co-regulated By This TF +
1 Glutathione S-transferase P (GSTP1) Clinical trial Target Target Info [4]
Cytokines / Cytokine receptors [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interferon-gamma (IFNG) Successful Target Target Info [5]
Endothelins/sarafotoxins [+] 1 Endothelins/sarafotoxins Co-regulated By This TF +
1 Endothelin-1 (EDN1) Literature-reported Target Target Info [6]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 Gonadotropin-releasing hormone receptor (GNRHR) Successful Target Target Info [1]
Glucagons [+] 1 Glucagons Co-regulated By This TF +
1 Vasoactive intestinal polypeptide (VIP) Literature-reported Target Target Info [7]
Hormones [+] 1 Hormones Co-regulated By This TF +
1 Corticoliberin (CRH) Literature-reported Target Target Info [8]
Integrins [+] 1 Integrins Co-regulated By This TF +
1 Integrin alpha-2 (ITGA2) Clinical trial Target Target Info [9]
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Quinone reductase 1 (NQO1) Clinical trial Target Target Info [10]
Peptidases [+] 1 Peptidases Co-regulated By This TF +
1 Urokinase-type plasminogen activator (PLAU) Successful Target Target Info [11]
Somatotropin / Prolactins [+] 1 Somatotropin / Prolactins Co-regulated By This TF +
1 Prolactin (PRL) Discontinued Target Target Info [12]
Transcription factors [+] 2 Transcription factors Co-regulated By This TF +
1 Cellular tumor antigen p53 (TP53) Clinical trial Target Target Info [13]
2 Transcription factor AP-1 (JUN) Discontinued Target Target Info [14]
TF Name Octamer-binding protein 1 (POU2F1)
Classification Superclass Helix-turn-helix
Class Homeo domain
Family POU domain factors
Regulation Type Increase
Regulation Mechanism Gel mobility assays confirmed the binding of POU2F1, CREB, GATA-2, GATA-3,AP-1 from JEG-3 cells to the four putative transcription factor-binding sites of the upstream placenta-specific promoter for GNRHR. [1]
Evidence Score (E-score) 2 +
1 Electrophoretic Mobility Shift Assay [3]
2 Reporter Assay, Electrophoretic Mobility Shift Assay [1]
UniProt ID
PO2F1_HUMAN
Sequence
MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTS
LQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQ
LLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQDLQQLQ
QLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQGLLQAQNLLTQLPQQSQANLLQSQ
PSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRI
KLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENLSSDS
SLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEK
EVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSLVTSSAATTLTVSP
VLPLTSAAVTNLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSA
SETSTTQTTSTPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANASLAAMAAAAGLNP
SLMAPSQFAAGGALLSLNPGTLSGALSPALMSNSTLATIQALASGGSLPITSLDATGNLV
FANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASAGNSAPVASLHATSTSAESIQ
NSLFTVASASGAASTTTTASKAQ
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Ester hydrolases [+] 1 Ester hydrolases Co-regulated By This TF +
1 Lipoprotein lipase (LPL) Successful Target Target Info [15]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 Gonadotropin-releasing hormone receptor (GNRHR) Successful Target Target Info [1]
Glycoproteins [+] 1 Glycoproteins Co-regulated By This TF +
1 von Willebrand factor (VWF) Successful Target Target Info [16]
TF Name GATA-binding factor 2 (GATA-2)
Classification Superclass Zinc-coordinating DNA-binding domains
Class diverse Cys4 zinc fingers
Family GATA-Factors
Subfamily vertebral GATA-Factors
Regulation Type Increase
Regulation Mechanism Gel mobility assays confirmed the binding of POU2F1, CREB, GATA-2, GATA-3,AP-1 from JEG-3 cells to the four putative transcription factor-binding sites of the upstream placenta-specific promoter for GNRHR. [1]
Evidence Score (E-score) 1 +
1 Reporter Assay, Electrophoretic Mobility Shift Assay [1]
UniProt ID
GATA2_HUMAN
Sequence
MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYY
ANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSP
FSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKE
VSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQP
ATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGA
TATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLW
RRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKC
MQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Endothelins/sarafotoxins [+] 1 Endothelins/sarafotoxins Co-regulated By This TF +
1 Endothelin-1 (EDN1) Literature-reported Target Target Info [6]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 Gonadotropin-releasing hormone receptor (GNRHR) Successful Target Target Info [1]
Glycoproteins [+] 1 Glycoproteins Co-regulated By This TF +
1 von Willebrand factor (VWF) Successful Target Target Info [17]
Hormones [+] 1 Hormones Co-regulated By This TF +
1 Erythropoietin (EPO) Clinical trial Target Target Info [18]
Oxidoreductases [+] 2 Oxidoreductases Co-regulated By This TF +
1 Estradiol 17 beta-dehydrogenase 1 (17-beta-HSD1) Clinical trial Target Target Info [19]
2 Nitric-oxide synthase endothelial (NOS3) Clinical trial Target Target Info [20]
Transcription factors [+] 1 Transcription factors Co-regulated By This TF +
1 Wilms tumor protein (WT1) Clinical trial Target Target Info [21]
TF Name cAMP-responsive element-binding (CREB) homodimer
Classification Superclass Basic Domains
Class Leucine zipper factors (bZIP)
Regulation Type Increase
Regulation Mechanism Gel mobility assays confirmed the binding of POU2F1, CREB, GATA-2, GATA-3,AP-1 from JEG-3 cells to the four putative transcription factor-binding sites of the upstream placenta-specific promoter for GNRHR. [1]
Evidence Score (E-score) 1 +
1 Reporter Assay, Electrophoretic Mobility Shift Assay [1]
UniProt ID
CREB1_HUMAN
Sequence
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apoptosis regulators [+] 1 Apoptosis regulators Co-regulated By This TF +
1 Apoptosis regulator Bcl-2 (BCL-2) Successful Target Target Info [22]
Cytokines / Cytokine receptors [+] 3 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interferon-gamma (IFNG) Successful Target Target Info [23]
2 Interleukin 5 receptor alpha (IL5RA) Successful Target Target Info [24]
3 Interleukin-1 beta (IL1B) Successful Target Target Info [25]
Fibronectin proteins [+] 1 Fibronectin proteins Co-regulated By This TF +
1 Fibronectin (FN1) Clinical trial Target Target Info [26]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 Gonadotropin-releasing hormone receptor (GNRHR) Successful Target Target Info [1]
Glucagons [+] 1 Glucagons Co-regulated By This TF +
1 Vasoactive intestinal polypeptide (VIP) Literature-reported Target Target Info [7]
Hormones [+] 2 Hormones Co-regulated By This TF +
1 Erythropoietin (EPO) Clinical trial Target Target Info [27]
2 Parathyroid hormone (PTH) Successful Target Target Info [28]
Immunoglobulins [+] 1 Immunoglobulins Co-regulated By This TF +
1 T-cell surface glycoprotein CD4 (CD4) Successful Target Target Info [29]
Lipoprotein receptors [+] 1 Lipoprotein receptors Co-regulated By This TF +
1 Low-density lipoprotein receptor (LDL-R) Successful Target Target Info [30]
Oxidoreductases [+] 2 Oxidoreductases Co-regulated By This TF +
1 Cholesterol desmolase (CYP11A1) Successful Target Target Info [31]
2 Dopamine beta hydroxylase (DBH) Clinical trial Target Target Info [32]
Peptidases [+] 1 Peptidases Co-regulated By This TF +
1 Tissue-type plasminogen activator (PLAT) Successful Target Target Info [33]
Transcription factors [+] 1 Transcription factors Co-regulated By This TF +
1 Early growth response protein 1 (EGR-1) Clinical trial Target Target Info [34]
Transferrins [+] 1 Transferrins Co-regulated By This TF +
1 Transferrin (TF) Clinical trial Target Target Info [35]
TF Name GATA-binding factor 3 (GATA-3)
Classification Superclass Zinc-coordinating DNA-binding domains
Class diverse Cys4 zinc fingers
Family GATA-Factors
Subfamily vertebral GATA-Factors
Regulation Type Increase
Regulation Mechanism Gel mobility assays confirmed the binding of POU2F1, CREB, GATA-2, GATA-3,AP-1 from JEG-3 cells to the four putative transcription factor-binding sites of the upstream placenta-specific promoter for GNRHR. [1]
Evidence Score (E-score) 1 +
1 Reporter Assay, Electrophoretic Mobility Shift Assay [1]
UniProt ID
GATA3_HUMAN
Sequence
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV
PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE
KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPL
IKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEG
IQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPT
PMHPPSSLSFGPHHPSSMVTAMG
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Cytokines / Cytokine receptors [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interferon-gamma (IFNG) Successful Target Target Info [36]
2 Interleukin-5 (IL5) Successful Target Target Info [37]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 Gonadotropin-releasing hormone receptor (GNRHR) Successful Target Target Info [1]
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Estradiol 17 beta-dehydrogenase 1 (17-beta-HSD1) Clinical trial Target Target Info [19]
References  Top
REF 1 Functional mapping of a placenta-specific upstream promoter for human gonadotropin-releasing hormone receptor gene. Endocrinology. 2001 Apr;142(4):1506-16.
REF 2 Transcriptional activation of the ovine follicle-stimulating hormone beta-subunit gene by gonadotropin-releasing hormone: involvement of two activa... Endocrinology. 1998 Nov;139(11):4455-65.
REF 3 Oct-1 is involved in the transcriptional repression of the gonadotropin-releasing hormone receptor gene. Endocrinology. 2002 Dec;143(12):4693-701.
REF 4 Involvement of Jun and Fos proteins in regulating transcriptional activation of the human pi class glutathione S-transferase gene in multidrug-resi... J Biol Chem. 1994 Jun 10;269(23):16397-402.
REF 5 Negative transcriptional regulation of the interferon-gamma promoter by glucocorticoids and dominant negative mutants of c-Jun. J Biol Chem. 1995 May 26;270(21):12548-56.
REF 6 Molecular regulation of the endothelin-1 gene by hypoxia. Contributions of hypoxia-inducible factor-1, activator protein-1, GATA-2, AND p300/CBP. J Biol Chem. 2001 Apr 20;276(16):12645-53.
REF 7 Cyclic AMP- and phorbol ester-induced transcriptional activation are mediated by the same enhancer element in the human vasoactive intestinal peptide gene. J Biol Chem. 1991 Feb 25;266(6):3882-7.
REF 8 Composite glucocorticoid regulation at a functionally defined negative glucocorticoid response element of the human corticotropin-releasing hormone gene. Mol Endocrinol. 1999 Oct;13(10):1629-44.
REF 9 The Megakaryocyte/Platelet-specific enhancer of the alpha2beta1 integrin gene: two tandem AP1 sites and the mitogen-activated protein kinase signal... Blood. 1999 Mar 1;93(5):1600-11.
REF 10 Human antioxidant-response-element-mediated regulation of type 1 NAD(P)H:quinone oxidoreductase gene expression. Effect of sulfhydryl modifying age... Eur J Biochem. 1994 Nov 15;226(1):31-9.
REF 11 Role of distinct mitogen-activated protein kinase pathways and cooperation between Ets-2, ATF-2, and Jun family members in human urokinase-type plasminogen activator gene induction by interleukin-1 and tetradecanoyl phorbol acetate. Mol Cell Biol. 1999 Sep;19(9):6240-52.
REF 12 Thyroid hormone inhibits the human prolactin gene promoter by interfering with activating protein-1 and estrogen stimulations. Mol Endocrinol. 1997 Jun;11(7):986-96.
REF 13 Expression of human p53 requires synergistic activation of transcription from the p53 promoter by AP-1, NF-kappaB and Myc/Max. Oncogene. 1999 Apr 29;18(17):2728-38.
REF 14 The jun proto-oncogene is positively autoregulated by its product, Jun/AP-1. Cell. 1988 Dec 2;55(5):875-85.
REF 15 Transcriptional regulation of the human lipoprotein lipase gene in 3T3-L1 adipocytes. J Biol Chem. 1991 Oct 5;266(28):18958-63.
REF 16 Oct-1 is involved in the transcriptional repression of the von willebrand factor gene promoter. Blood. 1998 Aug 15;92(4):1247-58.
REF 17 Endothelial-cell-specific regulation of von Willebrand factor gene expression. Mol Cell Biol. 1994 Feb;14(2):999-1008.
REF 18 N(G)-monomethyl-L-arginine inhibits erythropoietin gene expression by stimulating GATA-2. Blood. 2000 Sep 1;96(5):1716-22.
REF 19 The proximal promoter region of the gene encoding human 17beta-hydroxysteroid dehydrogenase type 1 contains GATA, AP-2, and Sp1 response elements: analysis of promoter function in choriocarcinoma cells. Endocrinology. 1997 Aug;138(8):3417-25.
REF 20 Functional analysis of the human endothelial nitric oxide synthase promoter. Sp1 and GATA factors are necessary for basal transcription in endothelial cells. J Biol Chem. 1995 Jun 23;270(25):15320-6.
REF 21 Transactivation of an intronic hematopoietic-specific enhancer of the human Wilms' tumor 1 gene by GATA-1 and c-Myb. J Biol Chem. 1997 Nov 14;272(46):29272-80.
REF 22 Induction of bcl-2 expression by phosphorylated CREB proteins during B-cell activation and rescue from apoptosis. Mol Cell Biol. 1996 Oct;16(10):5546-56.
REF 23 The proximal regulatory element of the interferon-gamma promoter mediates selective expression in T cells. J Biol Chem. 1996 Dec 13;271(50):31964-72.
REF 24 An AP-1 site in the promoter of the human IL-5R alpha gene is necessary for promoter activity in eosinophilic HL60 cells. FEBS Lett. 1998 Sep 4;434(3):251-4.
REF 25 Transcription factors NF-IL6 and CREB recognize a common essential site in the human prointerleukin 1 beta gene. Mol Cell Biol. 1994 Nov;14(11):7285-97.
REF 26 Cyclic AMP inhibits fibronectin gene expression in a newly developed granulosa cell line by a mechanism that suppresses cAMP-responsive element-dependent transcriptional activation. J Biol Chem. 1990 Oct 25;265(30):18219-26.
REF 27 The transcription factors ATF-1 and CREB-1 bind constitutively to the hypoxia-inducible factor-1 (HIF-1) DNA recognition site. Nucleic Acids Res. 1995 Nov 25;23(22):4542-50.
REF 28 A redox factor protein, ref1, is involved in negative gene regulation by extracellular calcium. J Biol Chem. 1994 Nov 11;269(45):27855-62.
REF 29 CD4 promoter transactivation by human herpesvirus 6. J Virol. 1998 Nov;72(11):8797-805.
REF 30 Identification of a novel sterol-independent regulatory element in the human low density lipoprotein receptor promoter. J Biol Chem. 2000 Feb 18;275(7):5214-21.
REF 31 Regulatory mechanisms of cAMP-dependent and cell-specific expression of human steroidogenic cytochrome P450scc (CYP11A1) gene. Eur J Biochem. 1994 Jun 15;222(3):825-34.
REF 32 Noradrenergic-specific transcription of the dopamine beta-hydroxylase gene requires synergy of multiple cis-acting elements including at least two Phox2a-binding sites. J Neurosci. 1998 Oct 15;18(20):8247-60.
REF 33 Differential binding of cAMP-responsive-element (CRE)-binding protein-1 and activating transcription factor-2 to a CRE-like element in the human tissue-type plasminogen activator (t-PA) gene promoter correlates with opposite regulation of t-PA by phorbol ester in HT-1080 and HeLa cells. Eur J Biochem. 1996 May 1;237(3):532-8.
REF 34 Granulocyte-macrophage colony-stimulating factor and interleukin-3 signaling pathways converge on the CREB-binding site in the human egr-1 promoter. Mol Cell Biol. 1994 Sep;14(9):5975-85.
REF 35 Brain-specific expression of the human transferrin gene. Similar elements govern transcription in oligodendrocytes and in a neuronal cell line. J Biol Chem. 1994 Sep 30;269(39):24504-10.
REF 36 Two essential regulatory elements in the human interferon gamma promoter confer activation specific expression in T cells. J Exp Med. 1993 Nov 1;178(5):1483-96.
REF 37 GATA-3 has dual regulatory functions in human interleukin-5 transcription. J Biol Chem. 2001 Dec 21;276(51):48502-9.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.