Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T32880
(Former ID: TTDI02433)
|
|||||
Target Name |
HIF-prolyl hydroxylase 2 (HPH-2)
|
|||||
Synonyms |
SM-20; Prolyl hydroxylase domain-containing protein 2; PHD2; Hypoxia-inducible factor prolyl hydroxylase 2; HPH-2; HIF-PH2; Egl nine homolog 1; C1orf12
|
|||||
Gene Name |
EGLN1
|
|||||
Target Type |
Patented-recorded target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Acute disease anaemia [ICD-11: 3A90] | |||||
2 | Urinary system disease [ICD-11: GC2Z] | |||||
Function |
Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF1B. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxic conditions, the hydroxylation reaction is attenuated allowing HIFs to escape degradation resulting in their translocation to the nucleus, heterodimerization with HIF1B, and increased expression of hypoxy-inducible genes. EGLN1 is the most important isozyme under normoxia and, through regulating the stability of HIF1, involved in various hypoxia-influenced processes such as angiogenesis in retinal and cardiac functionality. Target proteins are preferentially recognized via a LXXLAP motif.
Click to Show/Hide
|
|||||
BioChemical Class |
Paired donor oxygen oxidoreductase
|
|||||
UniProt ID | ||||||
EC Number |
EC 1.14.11.29
|
|||||
Sequence |
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQG
SEGALGHGVGPHQHSGPAPPAAVPPPRAGAREPRKAAARRDNASGDAAKGKVKAKPPADP AAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLR PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQL VSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMV ACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKF DRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDS VGKDVF Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T91N2D |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | FG-4592 | Drug Info | Phase 3 | Kidney disease | [2], [3] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Inhibitor | [+] 36 Inhibitor drugs | + | ||||
1 | FG-4592 | Drug Info | [4] | |||
2 | US10100051, Compound 1 | Drug Info | [5] | |||
3 | US10100051, Compound 10 | Drug Info | [5] | |||
4 | US10100051, Compound 11 | Drug Info | [5] | |||
5 | US10100051, Compound 2 | Drug Info | [5] | |||
6 | US10149841, Compound 1 | Drug Info | [6] | |||
7 | US10149841, Compound 19 | Drug Info | [6] | |||
8 | US10149841, Compound 5 | Drug Info | [6] | |||
9 | US10149841, Compound 9 | Drug Info | [6] | |||
10 | US8536181, A41 | Drug Info | [7] | |||
11 | US8536181, C14 | Drug Info | [7] | |||
12 | US8536181, C17 | Drug Info | [8] | |||
13 | US8536181, C35 | Drug Info | [7] | |||
14 | US8598210, Table XV, 1 | Drug Info | [9] | |||
15 | US8598210, Table XV, 2 | Drug Info | [10] | |||
16 | US8598210, Table XV, 4 | Drug Info | [9] | |||
17 | US8598210, Table XV, 5 | Drug Info | [11] | |||
18 | US8921389, 1 | Drug Info | [12] | |||
19 | US8921389, 123 | Drug Info | [13] | |||
20 | US8921389, 2 | Drug Info | [12] | |||
21 | US8921389, 210 | Drug Info | [12] | |||
22 | US8921389, 22 | Drug Info | [13] | |||
23 | US9340511, 2 | Drug Info | [14] | |||
24 | US9340511, 5 | Drug Info | [14] | |||
25 | US9340511, 6 | Drug Info | [15] | |||
26 | US9340511, 7 | Drug Info | [14] | |||
27 | US9409892, 136 | Drug Info | [16] | |||
28 | US9409892, 148 | Drug Info | [16] | |||
29 | US9409892, 19 | Drug Info | [16] | |||
30 | US9409892, 59 | Drug Info | [16] | |||
31 | US9422240, 1-282 | Drug Info | [17] | |||
32 | US9422240, 1-286 | Drug Info | [17] | |||
33 | US9422240, 1-297 | Drug Info | [17] | |||
34 | US9422240, 1-298 | Drug Info | [17] | |||
35 | IOX1 | Drug Info | [18] | |||
36 | IOX2 | Drug Info | [19] | |||
Activator | [+] 1 Activator drugs | + | ||||
1 | KRH-102053 | Drug Info | [1] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
1 | HIF-1 signaling pathway | |||||
2 | Pathways in cancer | |||||
3 | Renal cell carcinoma | |||||
Panther Pathway | [+] 1 Panther Pathways | + | ||||
1 | Hypoxia response via HIF activation | |||||
PID Pathway | [+] 3 PID Pathways | + | ||||
1 | HIF-2-alpha transcription factor network | |||||
2 | Hypoxic and oxygen homeostasis regulation of HIF-1-alpha | |||||
3 | HIF-1-alpha transcription factor network | |||||
Reactome | [+] 1 Reactome Pathways | + | ||||
1 | Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2833). | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8454). | |||||
REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023523) | |||||
REF 4 | Crystalline forms of a prolyl hydroxylase inhibitor. US9115085. | |||||
REF 5 | Compound of 5-hydroxyl-1,7-naphthyridine substituted by aryloxy or heteroaryloxy, preparation method thereof and pharmaceutical use thereof. US10100051. | |||||
REF 6 | Compound of 3-hydroxyl pyridine, preparation method thereof and pharmaceutical use thereof. US10149841. | |||||
REF 7 | Prolyl hydroxylase inhibitors. US8536181. | |||||
REF 8 | Methods for increasing the stabilization of hypoxia inducible factor-1 alpha. US8778412. | |||||
REF 9 | Prolyl hydroxylase inhibitors and methods of use. US8598210. | |||||
REF 10 | Prolyl hydroxylase inhibitors and methods of use. US9598370. | |||||
REF 11 | Prolyl hydroxylase inhibitors and method of use. US8722895. | |||||
REF 12 | Naphthyridine derivatives as inhibitors of Hypoxia inducible factor (HIF) hydroxylase. US9695170. | |||||
REF 13 | Naphthyridine derivatives as inhibitors of hypoxia inducible factor (HIF) hydroxylase. US8921389. | |||||
REF 14 | Process for making isoquinoline compounds. US9708269. | |||||
REF 15 | Process for making isoquinoline compounds. US9340511. | |||||
REF 16 | 4-hydroxy-isoquinoline compounds as HIF hydroxylase inhibitors. US9409892. | |||||
REF 17 | Partially saturated nitrogen-containing heterocyclic compound. US9422240. | |||||
REF 18 | A cell-permeable ester derivative of the JmjC histone demethylase inhibitor IOX1. ChemMedChem. 2014 Mar;9(3):566-71. | |||||
REF 19 | Selective small molecule probes for the hypoxia inducible factor (HIF) prolyl hydroxylases. ACS Chem Biol. 2013 Jul 19;8(7):1488-96. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.