Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T58992
(Former ID: TTDS00128)
|
|||||
Target Name |
Opioid receptor delta (OPRD1)
|
|||||
Synonyms |
OPRD; Delta-type opioid receptor; Delta opioid receptor; DOR-1; D-OR-1
Click to Show/Hide
|
|||||
Gene Name |
OPRD1
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 3 Target-related Diseases | + | ||||
1 | Bowel habit change [ICD-11: ME05] | |||||
2 | Irritable bowel syndrome [ICD-11: DD91] | |||||
3 | Pain [ICD-11: MG30-MG3Z] | |||||
Function |
Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain and in opiate-mediated analgesia. Plays a role in developing analgesic tolerance to morphine. G-protein coupled receptor that functions as receptor for endogenous enkephalins and for a subset of other opioids.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC TPSDGPGGGAAA Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
ADReCS ID | BADD_A03957 ; BADD_A05962 | |||||
HIT2.0 ID | T42O1D |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 6 Approved Drugs | + | ||||
1 | Butorphanol | Drug Info | Approved | Pain | [2], [3] | |
2 | Codeine | Drug Info | Approved | Pain | [4], [5] | |
3 | Eluxadoline | Drug Info | Approved | Diarrhea-predominant irritable bowel syndrome | [6], [7] | |
4 | Hydromorphone | Drug Info | Approved | Pain | [8] | |
5 | Loperamide | Drug Info | Approved | Diarrhea | [8] | |
6 | Oxycodone | Drug Info | Approved | Pain | [9], [10] | |
Clinical Trial Drug(s) | [+] 10 Clinical Trial Drugs | + | ||||
1 | ADL-5747 | Drug Info | Phase 2 | Pain | [11] | |
2 | ADL-5859 | Drug Info | Phase 2 | Rheumatoid arthritis | [12] | |
3 | AZD-2327 | Drug Info | Phase 2 | Anxiety disorder | [13] | |
4 | Met-enkephalin | Drug Info | Phase 2 | Pain | [14], [15] | |
5 | TPM-1/Morphine | Drug Info | Phase 2 | Pain | [16] | |
6 | AIKO-150 | Drug Info | Phase 1 | Opioid dependence | [17] | |
7 | MCP-201 | Drug Info | Phase 1 | Pain | [18] | |
8 | MCP-202 | Drug Info | Phase 1 | Overactive bladder | [19] | |
9 | SALVINORIN A | Drug Info | Phase 1 | Cerebral vasospasm | [20], [21] | |
10 | TRV250 | Drug Info | Phase 1 | Migraine | [21] | |
Discontinued Drug(s) | [+] 4 Discontinued Drugs | + | ||||
1 | DPI-3290 | Drug Info | Discontinued in Phase 2 | Pain | [22] | |
2 | TRK-851 | Drug Info | Discontinued in Phase 1 | Cough | [23] | |
3 | VP004 | Drug Info | Discontinued in Phase 1 | Substance use disorder | [24] | |
4 | SB-219825 | Drug Info | Terminated | Pain | [28] | |
Preclinical Drug(s) | [+] 3 Preclinical Drugs | + | ||||
1 | BIO-306 | Drug Info | Preclinical | Migraine | [25] | |
2 | LY-25582 | Drug Info | Preclinical | Obesity | [26] | |
3 | SoRI-9409 | Drug Info | Preclinical | Alcohol dependence | [27] | |
Mode of Action | [+] 5 Modes of Action | + | ||||
Agonist | [+] 38 Agonist drugs | + | ||||
1 | Butorphanol | Drug Info | [29] | |||
2 | Codeine | Drug Info | [29] | |||
3 | Oxycodone | Drug Info | [1] | |||
4 | ADL-5747 | Drug Info | [33] | |||
5 | ADL-5859 | Drug Info | [33] | |||
6 | AZD-2327 | Drug Info | [34] | |||
7 | Carfentanil | Drug Info | [35] | |||
8 | Met-enkephalin | Drug Info | [36], [37] | |||
9 | MCP-201 | Drug Info | [40] | |||
10 | MCP-202 | Drug Info | [41] | |||
11 | DPI-3290 | Drug Info | [43] | |||
12 | BIO-306 | Drug Info | [25] | |||
13 | BW 373U86 | Drug Info | [50] | |||
14 | 3-Methylfentanyl | Drug Info | [67] | |||
15 | 3-Methylthiofentanyl | Drug Info | [68] | |||
16 | ARD-412 | Drug Info | [33] | |||
17 | BBI-11008 | Drug Info | [33] | |||
18 | Beta-endorphin | Drug Info | [83] | |||
19 | DADLE | Drug Info | [90], [91] | |||
20 | Dihydromorphine | Drug Info | [97] | |||
21 | Dimethylthiambutene | Drug Info | [98] | |||
22 | DPI-221 | Drug Info | [33] | |||
23 | DSLET | Drug Info | [33] | |||
24 | DSTBULET | Drug Info | [102] | |||
25 | dynorphin B | Drug Info | [33] | |||
26 | ethyketazocine | Drug Info | [106] | |||
27 | ethylketocyclazocine | Drug Info | [33] | |||
28 | Etorphine | Drug Info | [108] | |||
29 | Leucine-enkephalin | Drug Info | [133] | |||
30 | MCP-203 | Drug Info | [33] | |||
31 | MCP-204 | Drug Info | [33] | |||
32 | MCP-205 | Drug Info | [33] | |||
33 | normorphine | Drug Info | [33] | |||
34 | NRP290 | Drug Info | [33] | |||
35 | SB 227122 | Drug Info | [148] | |||
36 | SNC-80 | Drug Info | [150], [151] | |||
37 | Tonazocine mesylate | Drug Info | [151] | |||
38 | [3H]diprenorphine | Drug Info | [33] | |||
Modulator | [+] 3 Modulator drugs | + | ||||
1 | Eluxadoline | Drug Info | [30] | |||
2 | TRV250 | Drug Info | [21] | |||
3 | SB-219825 | Drug Info | [52] | |||
Binder | [+] 2 Binder drugs | + | ||||
1 | Hydromorphone | Drug Info | [31] | |||
2 | Loperamide | Drug Info | [32] | |||
Inhibitor | [+] 347 Inhibitor drugs | + | ||||
1 | TPM-1/Morphine | Drug Info | [38] | |||
2 | AIKO-150 | Drug Info | [39] | |||
3 | SALVINORIN A | Drug Info | [42] | |||
4 | Dynorphin a | Drug Info | [44] | |||
5 | LY-25582 | Drug Info | [47] | |||
6 | BIPHALIN | Drug Info | [49] | |||
7 | SB-213698 | Drug Info | [51] | |||
8 | SNF-9007 | Drug Info | [53] | |||
9 | (-)-cyclorphan | Drug Info | [54] | |||
10 | (-)-eseroline | Drug Info | [55] | |||
11 | (-)-isoelaeocarpiline | Drug Info | [56] | |||
12 | (H-Dmt-Tic-Glu-NH-(CH(2))(5)-CO-Dap(6DMN)-NH(2) | Drug Info | [57] | |||
13 | 1,10-bis-(Dmt-Tic-amino)decane | Drug Info | [58] | |||
14 | 1,4-bis-(Dmt-Tic-amino)butane | Drug Info | [58] | |||
15 | 1,6-bis-(Dmt-Tic-amino)hexane | Drug Info | [58] | |||
16 | 1,6-bis-(N,N-dimethyl-Dmt-Tic-NH)hexane | Drug Info | [58] | |||
17 | 1-(1,2-diphenylethyl)-4-phenylpiperidin-4-ol | Drug Info | [59] | |||
18 | 1-(2-ethoxy-1-phenylethyl)-4-phenylpiperidin-4-ol | Drug Info | [59] | |||
19 | 1-(dio-tolylmethyl)-4-phenylpiperidin-4-ol | Drug Info | [59] | |||
20 | 1-benzhydryl-4-(2-fluorophenyl)piperidin-4-ol | Drug Info | [60] | |||
21 | 1-benzhydryl-4-(2-methoxyphenyl)piperidin-4-ol | Drug Info | [60] | |||
22 | 1-benzhydryl-4-(3-fluorophenyl)piperidin-4-ol | Drug Info | [60] | |||
23 | 1-benzhydryl-4-(3-methoxyphenyl)piperidin-4-ol | Drug Info | [60] | |||
24 | 1-benzhydryl-4-(3-phenylpropyl)piperidin-4-ol | Drug Info | [60] | |||
25 | 1-benzhydryl-4-(4-bromophenyl)piperidin-4-ol | Drug Info | [60] | |||
26 | 1-benzhydryl-4-(4-chlorophenyl)piperidin-4-ol | Drug Info | [60] | |||
27 | 1-benzhydryl-4-(4-fluorophenyl)piperidin-4-ol | Drug Info | [60] | |||
28 | 1-benzhydryl-4-(4-methoxyphenyl)piperidin-4-ol | Drug Info | [60] | |||
29 | 1-benzhydryl-4-(benzyloxy)-4-phenylpiperidine | Drug Info | [59] | |||
30 | 1-benzhydryl-4-(furan-2-yl)piperidin-4-ol | Drug Info | [60] | |||
31 | 1-benzhydryl-4-(thiophen-2-yl)piperidin-4-ol | Drug Info | [60] | |||
32 | 1-benzhydryl-4-benzylpiperidin-4-ol | Drug Info | [60] | |||
33 | 1-benzhydryl-4-butylpiperidin-4-ol | Drug Info | [60] | |||
34 | 1-benzhydryl-4-cyclohexylpiperidin-4-ol | Drug Info | [60] | |||
35 | 1-benzhydryl-4-ethoxy-4-phenylpiperidine | Drug Info | [59] | |||
36 | 1-benzhydryl-4-hexylpiperidin-4-ol | Drug Info | [60] | |||
37 | 1-benzhydryl-4-m-tolylpiperidin-4-ol | Drug Info | [60] | |||
38 | 1-benzhydryl-4-methoxy-4-phenylpiperidine | Drug Info | [59] | |||
39 | 1-benzhydryl-4-o-tolylpiperidin-4-ol | Drug Info | [60] | |||
40 | 1-benzhydryl-4-p-tolylpiperidin-4-ol | Drug Info | [60] | |||
41 | 1-benzhydryl-4-phenyl-4-propoxypiperidine | Drug Info | [59] | |||
42 | 1-benzhydryl-4-phenylpiperidin-4-ol | Drug Info | [61] | |||
43 | 1-[3-(3-biphenyl)-(1,2,4-triazol-4-yl) ]-3-phenol | Drug Info | [62] | |||
44 | 1-[3-(4-biphenyl)-(1,2,4-triazol-4-yl) ]-3-phenol | Drug Info | [62] | |||
45 | 14-O-phenylpropylnaltrexone | Drug Info | [63] | |||
46 | 17-(Cyclobutylmethyl)-N-phenylmorphinan-3-amine | Drug Info | [64] | |||
47 | 17-(Cyclopropylmethyl)-N-phenylmorphinan-3-amine | Drug Info | [64] | |||
48 | 17-methyl-4'-methyldihydromorphinone | Drug Info | [65] | |||
49 | 17-Methylmorphinan-3-yl 4-Iodophenyl Carbamate | Drug Info | [64] | |||
50 | 2-Hydroxymethyl-3-hydroxymorphinan | Drug Info | [64] | |||
51 | 3,6-bis(Dmt-Tic-NH-butyl)-2(1H)-pyrazinone | Drug Info | [58] | |||
52 | 3,6-bis(Dmt-Tic-NH-ethyl)-2(1H)-pyrazinone | Drug Info | [58] | |||
53 | 3,6-bis(Dmt-Tic-NH-methyl)-2(1H)-pyrazinone | Drug Info | [58] | |||
54 | 3,6-bis(Dmt-Tic-NH-propyl)-2(1H)-pyrazinone | Drug Info | [58] | |||
55 | 3-desoxy-3-carboxamidonaltrexone | Drug Info | [66] | |||
56 | 4-(4-((phenethylamino)methyl)phenoxy)benzamide | Drug Info | [69] | |||
57 | 4-(p-Tolyl)spiro[chromene-2,4'-piperidine] | Drug Info | [70] | |||
58 | 4-(Spiro[chromene-2,4'-piperidine]-4-yl)benzamide | Drug Info | [71] | |||
59 | 4-(Spiro[chromene-2,4'-piperidine]-4-yl)phenol | Drug Info | [70] | |||
60 | 4-phenyl-1-(1-phenylbutyl)piperidin-4-ol | Drug Info | [59] | |||
61 | 4-phenyl-1-(1-phenylheptyl)piperidin-4-ol | Drug Info | [59] | |||
62 | 4-phenyl-1-(1-phenylhexyl)piperidin-4-ol | Drug Info | [59] | |||
63 | 4-phenyl-1-(1-phenylpentyl)piperidin-4-ol | Drug Info | [59] | |||
64 | 4-phenyl-1-(phenyl(m-tolyl)methyl)piperidin-4-ol | Drug Info | [59] | |||
65 | 4-phenyl-1-(phenyl(o-tolyl)methyl)piperidin-4-ol | Drug Info | [59] | |||
66 | 4-phenyl-1-(phenyl(p-tolyl)methyl)piperidin-4-ol | Drug Info | [59] | |||
67 | 4-phenyl-4-[1H-imidazol-2-yl]-piperidine | Drug Info | [72] | |||
68 | 4-Phenylspiro[chromene-2,4'-piperidine] | Drug Info | [70] | |||
69 | 5-(4-((phenethylamino)methyl)phenoxy)picolinamide | Drug Info | [69] | |||
70 | 6-(2-phenethylisoindolin-5-yloxy)nicotinamide | Drug Info | [73] | |||
71 | 6-(4-((benzylamino)methyl)phenoxy)nicotinamide | Drug Info | [69] | |||
72 | 6-(4-((phenethylamino)methyl)phenoxy)nicotinamide | Drug Info | [73] | |||
73 | 6-(4-(2-(benzylamino)ethyl)phenoxy)nicotinamide | Drug Info | [73] | |||
74 | 6-(4-(3-(benzylamino)propyl)phenoxy)nicotinamide | Drug Info | [69] | |||
75 | 6-(Allyl-methyl-amino)-4,4-diphenyl-heptan-3-ol | Drug Info | [74] | |||
76 | 6-cinnamoyl-N-methylstephasunoline | Drug Info | [75] | |||
77 | 6-cinnamoylhernandine | Drug Info | [75] | |||
78 | 6-desoxonaltrexone | Drug Info | [66] | |||
79 | 6beta-naltrexol HCl | Drug Info | [76] | |||
80 | 8-azabicyclo[3.2.1]octan-3-yloxy-benzamide | Drug Info | [78] | |||
81 | 8-carboxamidocyclazocine | Drug Info | [79] | |||
82 | AKNADILACTAM | Drug Info | [75] | |||
83 | AMINOFENTANYL | Drug Info | [80] | |||
84 | ANALOG OF DYNORPHIN A | Drug Info | [44] | |||
85 | Antanal 1 | Drug Info | [81] | |||
86 | Antanal 2 | Drug Info | [81] | |||
87 | Benzyl derivative of M6G | Drug Info | [82] | |||
88 | Bis-((-)-N-propargylmorphinan-3-yl) sebacoylate | Drug Info | [54] | |||
89 | BUTORPHAN | Drug Info | [84] | |||
90 | CARBOXYFENTANYL | Drug Info | [85] | |||
91 | Cis-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH | Drug Info | [86] | |||
92 | Clocinnamox | Drug Info | [63] | |||
93 | CTOP | Drug Info | [81] | |||
94 | CYCLAZOCINE | Drug Info | [87] | |||
95 | CYCLORPHAN | Drug Info | [64] | |||
96 | C[L-mTyr-D-pro-L-Phe-D-trp] | Drug Info | [88] | |||
97 | C[L-Phe-D-pro-L-mTyr-D-trp] | Drug Info | [88] | |||
98 | C[L-Phe-D-pro-L-Phe-L-trp] | Drug Info | [88] | |||
99 | D-Phe-Cys-Tyr-D-Trp-Arg-Thr-Pen-Thr-NH2(CTAP) | Drug Info | [89] | |||
100 | D-Phe-Cys-Tyr-D-Trp-Lys-Thr-Pen-Thr-NH2(CTP) | Drug Info | [89] | |||
101 | D-Phe-Cys-Tyr-D-Trp-Orn-Thr-Pen-Thr-NH2(CTOP) | Drug Info | [89] | |||
102 | D-PhGly-Cys-Tyr-D-Trp-Lys-Thr-Pen-Thr-NH2 | Drug Info | [89] | |||
103 | DAMGO | Drug Info | [92] | |||
104 | Dcp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2 | Drug Info | [93] | |||
105 | DELTORPHIN | Drug Info | [94] | |||
106 | DELTORPHIN-II | Drug Info | [95] | |||
107 | Deprotected cogener of M6G | Drug Info | [82] | |||
108 | DERMORPHIN | Drug Info | [96] | |||
109 | Dhp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2 | Drug Info | [93] | |||
110 | Dimepheptanol | Drug Info | [74] | |||
111 | Dmt-Pro-3,5Dmp-Phe-NH2 | Drug Info | [100] | |||
112 | Dmt-Pro-Dmp-Phe-NH2 | Drug Info | [100] | |||
113 | Dmt-Pro-Dmt-Phe-NH2 | Drug Info | [100] | |||
114 | Dmt-Pro-Emp-Phe-NH2 | Drug Info | [100] | |||
115 | Dmt-Pro-Imp-Phe-NH2 | Drug Info | [100] | |||
116 | Dmt-Pro-Mmp-Phe-NH2 | Drug Info | [100] | |||
117 | Dmt-Pro-Phe-D-1-Nal-NH2 | Drug Info | [101] | |||
118 | Dmt-Pro-Phe-D-2-Nal-NH2 | Drug Info | [101] | |||
119 | Dmt-Pro-Phe-Phe-NH2 | Drug Info | [100] | |||
120 | Dmt-Pro-Tmp-Phe-NH2 | Drug Info | [100] | |||
121 | Dmt-Pro-Trp-D-2-Nal-NH2 | Drug Info | [101] | |||
122 | DPDPE | Drug Info | [92] | |||
123 | ELAEOCARPENINE | Drug Info | [103] | |||
124 | ENDOMORPHIN 2 | Drug Info | [104] | |||
125 | ENDOMORPHIN-1 | Drug Info | [105] | |||
126 | ETONITAZENE | Drug Info | [107] | |||
127 | FALCARINDIOL | Drug Info | [109] | |||
128 | Grandisine C | Drug Info | [56] | |||
129 | Grandisine D | Drug Info | [56] | |||
130 | Grandisine F | Drug Info | [56] | |||
131 | H-2',6'-dimethyltyrosine-Tic-OH | Drug Info | [110] | |||
132 | H-2',6'-dimethyltyrosine-Tic-Phe-Phe-OH | Drug Info | [110] | |||
133 | H-Aba-ala-Gly-Phe-leu-OH | Drug Info | [37] | |||
134 | H-Aba-ala-Gly-Phe-Met-OH | Drug Info | [37] | |||
135 | H-Aba-Gly-Gly-Phe-Leu-OH | Drug Info | [37] | |||
136 | H-Aba-ser-Gly-Phe-Leu-Thr-OH | Drug Info | [37] | |||
137 | H-Apa-ala-Gly-Phe-leu-OH | Drug Info | [37] | |||
138 | H-Cdp-ala-Gly-Phe-leu-OH | Drug Info | [37] | |||
139 | H-Cdp-Gly-Gly-Phe-Leu-OH | Drug Info | [37] | |||
140 | H-Cdp-ser-Gly-Phe-Leu-Thr-OH | Drug Info | [37] | |||
141 | H-Cpa-c[pen-Gly-Phe-pen]OH | Drug Info | [37] | |||
142 | H-Cpa-Gly-Gly-Phe-Met-NH2 | Drug Info | [37] | |||
143 | H-Cpa-Gly-Gly-Phe-Met-OH | Drug Info | [37] | |||
144 | H-Cxp-ala-Gly-Phe-leu-OH | Drug Info | [37] | |||
145 | H-D-Tca-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2 | Drug Info | [111] | |||
146 | H-D-Tic-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2 | Drug Info | [111] | |||
147 | H-D-Trp-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2 | Drug Info | [111] | |||
148 | H-Dmt-Aba-Gly-NH-CH2-Bid | Drug Info | [112] | |||
149 | H-Dmt-Aba-Gly-NH-CH2-Ph | Drug Info | [112] | |||
150 | H-Dmt-Aba-Gly-NH-Ph | Drug Info | [112] | |||
151 | H-Dmt-D-Arg(NO2)-Phe-Lys(Z)-NH2 | Drug Info | [113] | |||
152 | H-Dmt-D-Arg(NO2)-Phe-Lys(Z)-OH | Drug Info | [113] | |||
153 | H-Dmt-Tic-(2R,3R)-beta-MeCha-Phe-NH2 | Drug Info | [114] | |||
154 | H-Dmt-Tic-(2R,3R)-beta-MeCha-Phe-OH | Drug Info | [114] | |||
155 | H-Dmt-Tic-(2R,3S)-beta-MeCha-Phe-NH2 | Drug Info | [114] | |||
156 | H-Dmt-Tic-(2R,3S)-beta-MeCha-Phe-OH | Drug Info | [114] | |||
157 | H-Dmt-Tic-(2S,3R)-beta-MeCha-Phe-NH2 | Drug Info | [114] | |||
158 | H-Dmt-Tic-(2S,3R)-beta-MeCha-Phe-OH | Drug Info | [114] | |||
159 | H-Dmt-Tic-(2S,3S)-beta-MeCha-Phe-NH2 | Drug Info | [114] | |||
160 | H-Dmt-Tic-(2S,3S)-beta-MeCha-Phe-OH | Drug Info | [114] | |||
161 | H-Dmt-Tic-Asp-N(Me)-Ph | Drug Info | [115] | |||
162 | H-Dmt-Tic-Asp-NH-Bzl | Drug Info | [115] | |||
163 | H-Dmt-Tic-Asp-NH-Ph | Drug Info | [115] | |||
164 | H-Dmt-Tic-D-Asp-N(Me)-Ph | Drug Info | [115] | |||
165 | H-Dmt-Tic-D-Asp-NH-Ph | Drug Info | [115] | |||
166 | H-Dmt-Tic-Glu-Dap(6DMN)-NH(2) | Drug Info | [57] | |||
167 | H-Dmt-Tic-Glu-NH-(CH2)5-NH2 | Drug Info | [116] | |||
168 | H-Dmt-Tic-Glu-NH2 | Drug Info | [116] | |||
169 | H-Dmt-Tic-Gly-N(Me)-Ph | Drug Info | [115] | |||
170 | H-Dmt-Tic-Gly-NH-Bzl | Drug Info | [115] | |||
171 | H-Dmt-Tic-Gly-NH-CH2-Bid | Drug Info | [112] | |||
172 | H-Dmt-Tic-Gly-NH-Ph | Drug Info | [115] | |||
173 | H-Dmt-Tic-Lys(Ac)-NH-CH2-Ph | Drug Info | [117] | |||
174 | H-Dmt-Tic-Lys(Ac)-NH-Ph | Drug Info | [117] | |||
175 | H-Dmt-Tic-Lys(Z)-NH-CH2-Ph | Drug Info | [117] | |||
176 | H-Dmt-Tic-Lys(Z)-NH-Ph | Drug Info | [117] | |||
177 | H-Dmt-Tic-Lys-NH-CH2-Ph | Drug Info | [117] | |||
178 | H-Dmt-Tic-Lys-NH-Ph | Drug Info | [117] | |||
179 | H-Dmt-Tic-NH-(CH2)6-NH-Dmt-H | Drug Info | [118] | |||
180 | H-Dmt-Tic-NH-(CH2)6-NH-Phe-H | Drug Info | [118] | |||
181 | H-Dmt-Tic-NH-(CH2)6-NH-Tic-H | Drug Info | [118] | |||
182 | H-Dmt-Tic-NH-(D)-CH[(CH2)4-NH-Z]-Bid | Drug Info | [117] | |||
183 | H-Dmt-Tic-NH-(R)CH(CH2-COOH)-Bid | Drug Info | [115] | |||
184 | H-Dmt-Tic-NH-(R)CH(CH2-COOH)-Bid(N1-Me) | Drug Info | [115] | |||
185 | H-Dmt-Tic-NH-(S)CH(CH2-COOH)-Bid(N1-Me) | Drug Info | [115] | |||
186 | H-Dmt-Tic-NH-CH2-Boa | Drug Info | [119] | |||
187 | H-Dmt-Tic-NH-CH2-Bta | Drug Info | [119] | |||
188 | H-Dmt-Tic-NH-CH2-CH2-NH2 | Drug Info | [120] | |||
189 | H-Dmt-Tic-NH-CH2-Imid | Drug Info | [119] | |||
190 | H-Dmt-Tic-NH-CH2-ImidPh | Drug Info | [119] | |||
191 | H-Dmt-Tic-NH-CH2-Indl | Drug Info | [119] | |||
192 | H-Dmt-Tic-NH-CH2-Indn | Drug Info | [119] | |||
193 | H-Dmt-Tic-NH-CH[(CH2)4-NH-Ac]-Bid | Drug Info | [117] | |||
194 | H-Dmt-Tic-NH-CH[(CH2)4-NH-Z]-Bid | Drug Info | [117] | |||
195 | H-Dmt-Tic-NH-CH[(CH2)4-NH2]-Bid | Drug Info | [117] | |||
196 | H-mCpa-ala-Gly-Phe-leu-OH | Drug Info | [37] | |||
197 | H-mCpa-Gly-Gly-Phe-Leu-OH | Drug Info | [37] | |||
198 | H-mCpa-ser-Gly-Phe-Leu-Thr-OH | Drug Info | [37] | |||
199 | H-Poa-ser-Gly-Phe-Leu-Thr-OH | Drug Info | [37] | |||
200 | H-Tyr-c[cys-Gly-Phe(p-NO2)-cys]NH2 | Drug Info | [37] | |||
201 | H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]-OH | Drug Info | [86] | |||
202 | H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]NH2 | Drug Info | [121] | |||
203 | H-Tyr-c[D-Allylgly-Gly-Phe-L-Allylgly]NH2 | Drug Info | [121] | |||
204 | H-Tyr-c[D-Cys-Gly-Phe-D-Cys]NH2 | Drug Info | [121] | |||
205 | H-Tyr-c[D-Cys-Gly-Phe-L-Cys]NH2 | Drug Info | [121] | |||
206 | H-Tyr-c[D-Orn-(D or L)Atc-Glu]-NH2 | Drug Info | [122] | |||
207 | H-Tyr-c[D-Orn-Aic-Glu]-NH2 | Drug Info | [122] | |||
208 | H-Tyr-c[pen-Gly-Phe-pen]OH | Drug Info | [37] | |||
209 | H-Tyr-D-Ala-Gly Phe-Pro-Leu-Trp-O-3,5-Bzl(CF3)2 | Drug Info | [123] | |||
210 | H-Tyr-D-Ala-Gly-Phe-NH-NH-(NMe)Phe-Asp-Nle-Trp-Ac | Drug Info | [124] | |||
211 | H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Phe-D-Asp-D-Nle-Trp-H | Drug Info | [125] | |||
212 | H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Trp-Nle-Asp-Phe-Bo | Drug Info | [125] | |||
213 | H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Trp-Nle-Asp-Phe-H | Drug Info | [125] | |||
214 | H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-D-Trp-Boc | Drug Info | [124] | |||
215 | H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-D-Trp-H | Drug Info | [124] | |||
216 | H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-Trp-Ac | Drug Info | [124] | |||
217 | H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-Trp-Boc | Drug Info | [124] | |||
218 | H-Tyr-D-Ala-Gly-Phe-NH-NH-Trp-D-Nle-D-Asp-D-Phe-H | Drug Info | [125] | |||
219 | H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NH-3,5-Bzl(CF3)2 | Drug Info | [123] | |||
220 | H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NH-Bzl | Drug Info | [123] | |||
221 | H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NMe-3,5-Bzl(CF3)2 | Drug Info | [123] | |||
222 | H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NMe-Bzl | Drug Info | [123] | |||
223 | H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-O-Bzl | Drug Info | [123] | |||
224 | H-Tyr-Gly-Gly-Phe-Met-NH2 | Drug Info | [37] | |||
225 | H-Tyr-NMe-D-Ala-Phe-Sar-NH2 | Drug Info | [126] | |||
226 | H-Tyr-Pro-Dap(6DMN)-Phe-NH2 | Drug Info | [57] | |||
227 | H-Tyr-Pro-Phe-Phe-NH-(CH2)5-(C=O)-Dap(6DMN)-NH2 | Drug Info | [57] | |||
228 | H-Tyr-Pro-Phe-Phe-NH-CH2-CH2-NH Tic Dmt-H | Drug Info | [120] | |||
229 | H-Tyr-Tic-Cha-Phe-OH | Drug Info | [114] | |||
230 | H-Tyr-Tic-OH | Drug Info | [110] | |||
231 | H-Tyr-Tic-Phe-Phe-OH | Drug Info | [114], [127] | |||
232 | HERKINORIN | Drug Info | [42] | |||
233 | HTyr-Gly-Gly-Phe-Leu-Arg-Arg-lle-Arg-Pro-LysNH2 | Drug Info | [128] | |||
234 | ICI-174864 | Drug Info | [130] | |||
235 | ICI-199441 | Drug Info | [131] | |||
236 | Isoelaeocarpine | Drug Info | [132] | |||
237 | LOFENTANIL | Drug Info | [134] | |||
238 | LONGANINE | Drug Info | [75] | |||
239 | Lophocladine a | Drug Info | [135] | |||
240 | M6G thiosaccharide analogue | Drug Info | [82] | |||
241 | MC-CAM | Drug Info | [136] | |||
242 | MCL-117 | Drug Info | [54] | |||
243 | MCL-139 | Drug Info | [54] | |||
244 | MCL-144 | Drug Info | [137] | |||
245 | MCL-145 | Drug Info | [54] | |||
246 | MCL-147 | Drug Info | [138] | |||
247 | MCL-149 | Drug Info | [138] | |||
248 | MCL-153 | Drug Info | [84] | |||
249 | MCL-154 | Drug Info | [84] | |||
250 | MCL-182 | Drug Info | [138] | |||
251 | MCL-183 | Drug Info | [138] | |||
252 | MCL-428 | Drug Info | [139] | |||
253 | MCL-429 | Drug Info | [139] | |||
254 | MCL-431 | Drug Info | [139] | |||
255 | MCL-432 | Drug Info | [139] | |||
256 | MCL-433 | Drug Info | [139] | |||
257 | MCL-434 | Drug Info | [139] | |||
258 | MCL-435 | Drug Info | [139] | |||
259 | MCL-443 | Drug Info | [139] | |||
260 | MCL-444 | Drug Info | [139] | |||
261 | MCL-445 | Drug Info | [138] | |||
262 | MCL-446 | Drug Info | [138] | |||
263 | MCL-447 | Drug Info | [138] | |||
264 | MCL-448 | Drug Info | [138] | |||
265 | MCL-449 | Drug Info | [139] | |||
266 | MCL-450 | Drug Info | [140] | |||
267 | MCL-451 | Drug Info | [140] | |||
268 | MCL-458 | Drug Info | [138] | |||
269 | METAZOCINE | Drug Info | [39] | |||
270 | N-(17-Methylmorphinan-3-yl)-N'-phenylurea | Drug Info | [64] | |||
271 | N-(4-Iodophenyl)-N'-(17-methylmorphinan-3-yl)urea | Drug Info | [64] | |||
272 | N-alpha-amidino-Tyr(Me)-Pro-Trp-p-Cl-Phe-NH2 | Drug Info | [141] | |||
273 | N-alpha-amidino-Tyr(Me)-Pro-Trp-Phe-NH2 | Drug Info | [141] | |||
274 | N-Benzyl-17-(cyclobutylmethyl)morphinan-3-amine | Drug Info | [64] | |||
275 | N-Benzyl-17-(cyclopropylmethyl)morphinan-3-amine | Drug Info | [64] | |||
276 | N-methylstephisoferulin | Drug Info | [75] | |||
277 | N-methylstephuline | Drug Info | [75] | |||
278 | Naltrexone-6-alpha-ol | Drug Info | [39] | |||
279 | NORBINALTORPHIMINE | Drug Info | [144] | |||
280 | O-DESMETHYL TRAMADOL | Drug Info | [39] | |||
281 | OXYMORPHINDOLE | Drug Info | [145] | |||
282 | PERIPENTADENINE | Drug Info | [146] | |||
283 | PHENAZOCINE | Drug Info | [39] | |||
284 | PROSTEPHABYSSINE | Drug Info | [75] | |||
285 | RTI-5989-23 | Drug Info | [47] | |||
286 | RTI-5989-25 | Drug Info | [47] | |||
287 | RTI-5989-31 | Drug Info | [147] | |||
288 | SB-0304 | Drug Info | [126] | |||
289 | SN-11 | Drug Info | [51] | |||
290 | SN-23 | Drug Info | [51] | |||
291 | SN-28 | Drug Info | [149] | |||
292 | SOMATOSTATIN | Drug Info | [89] | |||
293 | Trans-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH | Drug Info | [86] | |||
294 | Tyr-(NMe)Ala-L-Phe-D-Pro-NH2 | Drug Info | [153] | |||
295 | Tyr-(R)-Aba-Gly-Phe-NH2 | Drug Info | [154] | |||
296 | Tyr-(S)-Aba-Gly-Phe-NH2 | Drug Info | [154] | |||
297 | Tyr-(S)-spiro-Aba-Gly-Phe-NH2 | Drug Info | [154] | |||
298 | Tyr-D-Ala-Gly-D-Trp-Nle-Asp-Phe-NH2 | Drug Info | [53] | |||
299 | Tyr-D-Ala-Gly-D-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
300 | Tyr-D-Ala-Gly-Phe-Met-NH2 | Drug Info | [49] | |||
301 | Tyr-D-Ala-Gly-Phe-Met-Pro-Leu-Trp-NH-Bzl | Drug Info | [155] | |||
302 | Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-NMeNle-D-Trp-Boc | Drug Info | [124] | |||
303 | Tyr-D-Ala-Gly-Trp-Nle-Asp-Phe-NH2 | Drug Info | [53] | |||
304 | Tyr-D-Ala-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
305 | Tyr-D-Ala-Phe-Asp-Val-Val-Thr[Beta-D-Glc]-Gly-NH2 | Drug Info | [156] | |||
306 | Tyr-D-Ala-Phe-Glu-Val-Val-Gly-NH2 | Drug Info | [157] | |||
307 | Tyr-D-Ala-Phe-Gly-Tyr-Pro-Thr(Beta-D-Glc)-Gly-NH2 | Drug Info | [156] | |||
308 | Tyr-D-Ala-Phe-Thr(-D-Glc)-Tyr-Pro-Ser-NH2 | Drug Info | [156] | |||
309 | Tyr-D-Met-Phe-His-Leu-Met-Asp-NH2 | Drug Info | [157] | |||
310 | Tyr-D-Nle-Gly-D-Trp-Nle-Asp-Phe-NH2 | Drug Info | [53] | |||
311 | Tyr-D-Nle-Gly-D-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
312 | Tyr-D-Nle-Gly-Trp-Nle-Asp-Phe-NH2 | Drug Info | [53] | |||
313 | Tyr-D-Nle-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
314 | Tyr-D-Phe-Gly-D-Trp-Nle-Asp-Phe-NH2 | Drug Info | [53] | |||
315 | Tyr-D-Phe-Gly-D-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
316 | Tyr-D-Phe-Gly-Trp-Nle-Asp-Phe-NH2 | Drug Info | [53] | |||
317 | Tyr-D-Phe-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
318 | Tyr-D-Pro-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
319 | Tyr-Gly-Gly-Phe-c(Cys-Arg-Arg-Ile-Cys)-Arg-lys | Drug Info | [44] | |||
320 | Tyr-Gly-Gly-Phe-leu-c(Cys-Arg-Ile-Arg-Cys)-lys | Drug Info | [44] | |||
321 | Tyr-Gly-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
322 | Tyr-Pro-3,5Dmp-Phe-NH2 | Drug Info | [100] | |||
323 | Tyr-Pro-D-Phe-D-Pro-NH2 | Drug Info | [153] | |||
324 | Tyr-Pro-D-Phe-Pro-NH2 | Drug Info | [153] | |||
325 | Tyr-Pro-D-Phg-Phe-NH2 | Drug Info | [158] | |||
326 | Tyr-Pro-Dmp-Phe-NH2 | Drug Info | [100] | |||
327 | Tyr-Pro-Dmt-Phe-NH2 | Drug Info | [100] | |||
328 | Tyr-Pro-Emp-Phe-NH2 | Drug Info | [100] | |||
329 | Tyr-Pro-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [53] | |||
330 | Tyr-Pro-Imp-Phe-NH2 | Drug Info | [100] | |||
331 | Tyr-Pro-L-(NMe)Phe-D-Pro-NH2 | Drug Info | [153] | |||
332 | Tyr-Pro-L-(NMe)Phe-Pro-NH2 | Drug Info | [153] | |||
333 | Tyr-Pro-L-Phe-D-Pro-NH2 | Drug Info | [153] | |||
334 | Tyr-Pro-L-Phe-Pro-NH2 | Drug Info | [153] | |||
335 | Tyr-Pro-Mmp-Phe-NH | Drug Info | [100] | |||
336 | Tyr-Pro-Phe-Phe-N(CH3)2 | Drug Info | [159] | |||
337 | Tyr-Pro-Phe-Phe-NHCH3 | Drug Info | [159] | |||
338 | Tyr-Pro-Phe-Phe-NHNH2 | Drug Info | [159] | |||
339 | Tyr-Pro-Phe-Phe-OC(CH3)3 | Drug Info | [159] | |||
340 | Tyr-Pro-Phe-Phe-OCH2CH3 | Drug Info | [159] | |||
341 | Tyr-Pro-Phe-Phe-OCH2OH | Drug Info | [159] | |||
342 | Tyr-Pro-Phe-Phe-OCH3 | Drug Info | [159] | |||
343 | Tyr-Pro-Tmp-Phe-NH | Drug Info | [100] | |||
344 | UFP-502 | Drug Info | [95] | |||
345 | UFP-512 | Drug Info | [95] | |||
346 | [Dcp1]Dyn A(1-11)-NH2 | Drug Info | [93] | |||
347 | [Leu5]enkephalin | Drug Info | [161] | |||
Antagonist | [+] 11 Antagonist drugs | + | ||||
1 | TRK-851 | Drug Info | [8], [45] | |||
2 | SoRI-9409 | Drug Info | [48] | |||
3 | 7-benzylidenenaltrexone | Drug Info | [77] | |||
4 | CTAP | Drug Info | [33] | |||
5 | Diprenorphine | Drug Info | [99] | |||
6 | ICI 154129 | Drug Info | [129] | |||
7 | naltriben | Drug Info | [142], [143] | |||
8 | quadazocine | Drug Info | [33] | |||
9 | TIP | Drug Info | [127] | |||
10 | TIPPpsi | Drug Info | [152] | |||
11 | [3H]naltrindole | Drug Info | [77], [160] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Drug Binding Sites of Target | Top | |||||
---|---|---|---|---|---|---|
Ligand Name: Naltrindole | Ligand Info | |||||
Structure Description | 1.8 A Structure of the human delta opioid 7TM receptor (PSI Community Target) | PDB:4N6H | ||||
Method | X-ray diffraction | Resolution | 1.80 Å | Mutation | Yes | [162] |
PDB Sequence |
DLEDNWETLN
1011 DNLKVIEKAD1021 NAAQVKDALT1031 KMRAAALDAQ1041 KATPPKLEDK1051 SPDSPEMKDF 1061 RHGFDILVGQ1071 IDDALKLANE1081 GKVKEAQAAA1091 EQLKTTRNAY1101 IQKYLGSPGA 40 RSASSLALAI50 AITALYSAVC60 AVGLLGNVLV70 MFGIVRYTKM80 KTATNIYIFN 90 LALADALATS100 TLPFQSAKYL110 METWPFGELL120 CKAVLSIDYY130 NMFTSIFTLT 140 MMSVDRYIAV150 CHPVKALDFR160 TPAKAKLINI170 CIWVLASGVG180 VPIMVMAVTR 190 PRDGAVVCML200 QFPSPSWYWD210 TVTKICVFLF220 AFVVPILIIT230 VCYGLMLLRL 240 RSVRLLSGSK250 EKDRSLRRIT260 RMVLVVVGAF270 VVCWAPIHIF280 VIVWTLVDID 290 RRDPLVVAAL300 HLCIALGYAN310 SSLNPVLYAF320 LDENFKRCFR330 QLCRKPCG |
|||||
|
||||||
Ligand Name: Oleic acid | Ligand Info | |||||
Structure Description | 1.8 A Structure of the human delta opioid 7TM receptor (PSI Community Target) | PDB:4N6H | ||||
Method | X-ray diffraction | Resolution | 1.80 Å | Mutation | Yes | [162] |
PDB Sequence |
DLEDNWETLN
1011 DNLKVIEKAD1021 NAAQVKDALT1031 KMRAAALDAQ1041 KATPPKLEDK1051 SPDSPEMKDF 1061 RHGFDILVGQ1071 IDDALKLANE1081 GKVKEAQAAA1091 EQLKTTRNAY1101 IQKYLGSPGA 40 RSASSLALAI50 AITALYSAVC60 AVGLLGNVLV70 MFGIVRYTKM80 KTATNIYIFN 90 LALADALATS100 TLPFQSAKYL110 METWPFGELL120 CKAVLSIDYY130 NMFTSIFTLT 140 MMSVDRYIAV150 CHPVKALDFR160 TPAKAKLINI170 CIWVLASGVG180 VPIMVMAVTR 190 PRDGAVVCML200 QFPSPSWYWD210 TVTKICVFLF220 AFVVPILIIT230 VCYGLMLLRL 240 RSVRLLSGSK250 EKDRSLRRIT260 RMVLVVVGAF270 VVCWAPIHIF280 VIVWTLVDID 290 RRDPLVVAAL300 HLCIALGYAN310 SSLNPVLYAF320 LDENFKRCFR330 QLCRKPCG |
|||||
|
ALA47
3.594
LEU48
3.835
ILE50
4.281
ALA51
3.883
ALA54
3.583
LEU55
3.528
ALA58
3.811
CYS60
4.375
LEU64
4.150
MET71
3.997
PHE72
3.842
VAL75
3.839
ALA83
4.516
TYR87
2.568
PHE89
4.231
LEU93
4.063
ALA96
3.956
LEU97
4.130
SER100
3.372
THR101
4.491
PRO103
3.757
PHE104
4.051
ALA107
4.212
PRO115
3.024
PHE116
3.347
GLY117
4.037
LEU120
4.504
VAL124
4.931
ILE127
4.078
MET141
3.957
VAL144
4.649
ASP145
2.709
ILE148
3.895
PHE159
3.301
ARG160
3.823
THR161
3.646
LYS164
3.891
ALA165
3.780
ILE168
3.717
TYR233
3.250
LEU237
3.726
ARG261
3.328
LEU264
4.076
VAL265
4.119
GLY268
3.886
ALA269
3.951
VAL271
4.172
VAL272
3.653
CYS273
4.017
ALA275
4.362
PRO276
3.737
ILE279
3.637
PHE280
3.952
VAL283
4.095
VAL287
3.710
ASP288
3.451
ILE289
3.612
ASP290
2.702
ASP293
3.174
LEU295
3.387
VAL296
3.543
ALA298
4.577
ALA299
4.120
LEU302
4.246
CYS303
4.234
LEU306
3.926
ALA309
4.042
LEU313
3.725
VAL316
3.694
LEU317
4.280
PHE320
3.506
LEU321
3.874
|
|||||
Click to View More Binding Site Information of This Target and Ligand Pair | ||||||
Click to View More Binding Site Information of This Target with Different Ligands |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Human Similarity Proteins
Human Pathway Affiliation
|



KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
cGMP-PKG signaling pathway | hsa04022 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Sphingolipid signaling pathway | hsa04071 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
1 | cGMP-PKG signaling pathway | |||||
2 | Sphingolipid signaling pathway | |||||
3 | Neuroactive ligand-receptor interaction | |||||
Panther Pathway | [+] 5 Panther Pathways | + | ||||
1 | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
2 | Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
3 | Enkephalin release | |||||
4 | Opioid proenkephalin pathway | |||||
5 | Opioid proopiomelanocortin pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Peptide ligand-binding receptors | |||||
2 | G alpha (i) signalling events | |||||
WikiPathways | [+] 4 WikiPathways | + | ||||
1 | GPCRs, Class A Rhodopsin-like | |||||
2 | Peptide GPCRs | |||||
3 | GPCR ligand binding | |||||
4 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Oxycodone: a pharmacological and clinical review. Clin Transl Oncol. 2007 May;9(5):298-307. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7591). | |||||
REF 3 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075046. | |||||
REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1673). | |||||
REF 5 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074256. | |||||
REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7691). | |||||
REF 7 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031329) | |||||
REF 8 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7093). | |||||
REF 10 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 085910. | |||||
REF 11 | ClinicalTrials.gov (NCT01058642) Study to Assess the Efficacy, Safety, and Tolerability of ADL5747 in Patients With Postherpetic Neuralgia. U.S. National Institutes of Health. | |||||
REF 12 | ClinicalTrials.gov (NCT00626275) Study Evaluating the Analgesic Efficacy and Safety of ADL5859 in Subjects With Rheumatoid Arthritis. U.S. National Institutes of Health. | |||||
REF 13 | ClinicalTrials.gov (NCT00759395) Study of Antidepressant Efficacy of a Selective, High Affinity Enkephalinergic Agonist in Anxious Major Depressive Disorder (AMDD). U.S. National Institutes of Health. | |||||
REF 14 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1614). | |||||
REF 15 | ClinicalTrials.gov (NCT00109941) Opioid Growth Factor in Treating Patients With Advanced Pancreatic Cancer That Cannot Be Removed By Surgery. U.S. National Institutes of Health. | |||||
REF 16 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023017) | |||||
REF 17 | ClinicalTrials.gov (NCT00829777) Safety Study of Intravenous 6 Naltrexol (AIKO-150) in Opioid-Dependent Subjects. U.S. National Institutes of Health. | |||||
REF 18 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018011) | |||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018026) | |||||
REF 20 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 21 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 22 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010668) | |||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015232) | |||||
REF 24 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025668) | |||||
REF 25 | Pharmacologic therapeutics for cardiac reperfusion injury. Expert Opin Emerg Drugs. 2007 Sep;12(3):367-88. | |||||
REF 26 | Emerging drugs for obesity: linking novel biological mechanisms to pharmaceutical pipelines. Expert Opin Emerg Drugs. 2005 Aug;10(3):643-60. | |||||
REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028893) | |||||
REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008418) | |||||
REF 29 | Butorphanol: effects of a prototypical agonist-antagonist analgesic on kappa-opioid receptors. J Pharmacol Sci. 2005 Jun;98(2):109-16. | |||||
REF 30 | Molecular characterization of eluxadoline as a potential ligand targeting mu-delta opioid receptor heteromers.Biochem Pharmacol.2014 Dec 1;92(3):448-56. | |||||
REF 31 | Identification of opioid ligands possessing mixed micro agonist/delta antagonist activity among pyridomorphinans derived from naloxone, oxymorphone, and hydromorphone [correction of hydropmorphone]. J Med Chem. 2004 Mar 11;47(6):1400-12. | |||||
REF 32 | Loperamide: evidence of interaction with mu and delta opioid receptors. Life Sci. 1983;33 Suppl 1:315-8. | |||||
REF 33 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 317). | |||||
REF 34 | Preclinical pharmacology of AZD2327: a highly selective agonist of the delta-opioid receptor. J Pharmacol Exp Ther. 2011 Jul;338(1):195-204. | |||||
REF 35 | Wax PM, Becker CE, Curry SC: Unexpected gas casualties in Moscow: a medical toxicology perspective. Ann Emerg Med. 2003 May;41(5):700-5. | |||||
REF 36 | Delta-opioid receptor agonists inhibit neuromuscular transmission in human colon. Eur J Pharmacol. 1994 Sep 1;262(1-2):33-9. | |||||
REF 37 | Further studies of tyrosine surrogates in opioid receptor peptide ligands. Bioorg Med Chem Lett. 2007 May 1;17(9):2656-60. | |||||
REF 38 | Molecular Mechanisms of Opioid Receptor-Dependent Signaling and Behavior. Anesthesiology. 2011 December; 115(6): 1363-1381. | |||||
REF 39 | Syntheses and opioid receptor binding properties of carboxamido-substituted opioids. Bioorg Med Chem Lett. 2009 Jan 1;19(1):203-8. | |||||
REF 40 | US patent application no. 6,924,288, Enantiomerically pure opioid diarylmethylpiperzine and methods of using same. | |||||
REF 41 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018026) | |||||
REF 42 | Herkinorin analogues with differential beta-arrestin-2 interactions. J Med Chem. 2008 Apr 24;51(8):2421-31. | |||||
REF 43 | DPI-3290 [(+)-3-((alpha-R)-alpha-((2S,5R)-4-Allyl-2,5-dimethyl-1-piperazinyl)-3-hydroxybenzyl)-N-(3-fluorophenyl)-N-methylbenzamide]. II. A mixed opioid agonist with potent antinociceptive activity and limited effects on respiratory function. J Pharmacol Exp Ther. 2003 Dec;307(3):1227-33. | |||||
REF 44 | Design and synthesis of highly potent and selective cyclic dynorphin A analogs. 2. New analogs. J Med Chem. 1993 Mar 19;36(6):750-7. | |||||
REF 45 | Design and synthesis of a metabolically stable and potent antitussive agent, a novel delta opioid receptor antagonist, TRK-851. Bioorg Med Chem. 2008 Sep 1;16(17):7956-67. | |||||
REF 46 | WO patent application no. 2007,0677,14, Treatment of sequelae of psychiatric disorders. | |||||
REF 47 | Investigation of the N-substituent conformation governing potency and mu receptor subtype-selectivity in (+)-(3R, 4R)-dimethyl-4-(3-hydroxyphenyl)p... J Med Chem. 1998 May 21;41(11):1980-90. | |||||
REF 48 | In vivo pharmacological characterization of SoRI 9409, a nonpeptidic opioid mu-agonist/delta-antagonist that produces limited antinociceptive tolerance and attenuates morphine physical dependence. J Pharmacol Exp Ther. 2001 May;297(2):597-605. | |||||
REF 49 | The biological activity and metabolic stability of peptidic bifunctional compounds that are opioid receptor agonists and neurokinin-1 receptor anta... Bioorg Med Chem. 2009 Oct 15;17(20):7337-43. | |||||
REF 50 | BW373U86, a delta opioid agonist, partially mediates delayed cardioprotection via a free radical mechanism that is independent of opioid receptor stimulation. J Mol Cell Cardiol. 2001 Aug;33(8):1455-65. | |||||
REF 51 | Design and synthesis of novel delta opioid receptor agonists and their pharmacologies. Bioorg Med Chem Lett. 2009 May 15;19(10):2792-5. | |||||
REF 52 | Mutation W284L of the human delta opioid receptor reveals agonist specific receptor conformations for G protein activation. Life Sci. 2001 Apr 6;68(19-20):2233-42. | |||||
REF 53 | Structure-activity relationships of bifunctional peptides based on overlapping pharmacophores at opioid and cholecystokinin receptors. J Med Chem. 2006 May 18;49(10):2868-75. | |||||
REF 54 | Synthesis and preliminary in vitro investigation of bivalent ligands containing homo- and heterodimeric pharmacophores at mu, delta, and kappa opio... J Med Chem. 2006 Jan 12;49(1):256-62. | |||||
REF 55 | Akuammine and dihydroakuammine, two indolomonoterpene alkaloids displaying affinity for opioid receptors. J Nat Prod. 1992 Mar;55(3):380-4. | |||||
REF 56 | Grandisines C-G, indolizidine alkaloids from the Australian rainforest tree Elaeocarpus grandis. J Nat Prod. 2006 Sep;69(9):1295-9. | |||||
REF 57 | 6-N,N-dimethylamino-2,3-naphthalimide: a new environment-sensitive fluorescent probe in delta- and mu-selective opioid peptides. J Med Chem. 2006 Jun 15;49(12):3653-8. | |||||
REF 58 | Potent Dmt-Tic pharmacophoric delta- and mu-opioid receptor antagonists. J Med Chem. 2005 Dec 15;48(25):8035-44. | |||||
REF 59 | Bioorg Med Chem Lett. 2007 Jun 1;17(11):3023-7. Epub 2007 Mar 23.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 1. | |||||
REF 60 | Bioorg Med Chem Lett. 2007 Jun 1;17(11):3028-33. Epub 2007 Mar 21.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 2. | |||||
REF 61 | The discovery of tropane derivatives as nociceptin receptor ligands for the management of cough and anxiety. Bioorg Med Chem Lett. 2009 May 1;19(9):2519-23. | |||||
REF 62 | Discovery of novel triazole-based opioid receptor antagonists. J Med Chem. 2006 Jul 13;49(14):4044-7. | |||||
REF 63 | 14 beta-O-cinnamoylnaltrexone and related dihydrocodeinones are mu opioid receptor partial agonists with predominant antagonist activity. J Med Chem. 2009 Mar 26;52(6):1553-7. | |||||
REF 64 | Synthesis and opioid receptor binding affinities of 2-substituted and 3-aminomorphinans: ligands for mu, kappa, and delta opioid receptors. J Med Chem. 2010 Jan 14;53(1):402-18. | |||||
REF 65 | Structural determinants of opioid activity in derivatives of 14-aminomorphinones: effect of substitution in the aromatic ring of cinnamoylaminomorp... J Med Chem. 2006 Aug 24;49(17):5333-8. | |||||
REF 66 | Syntheses of novel high affinity ligands for opioid receptors. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2289-94. | |||||
REF 67 | Subramanian G, Paterlini MG, Portoghese PS, Ferguson DM: Molecular docking reveals a novel binding site model for fentanyl at the mu-opioid receptor. J Med Chem. 2000 Feb 10;43(3):381-91. | |||||
REF 68 | You HJ, Colpaert FC, Arendt-Nielsen L: The novel analgesic and high-efficacy 5-HT1A receptor agonist F 13640 inhibits nociceptive responses, wind-up, and after-discharges in spinal neurons and withdrawal reflexes. Exp Neurol. 2005 Jan;191(1):174-83. | |||||
REF 69 | Structure-activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 1. Bioorg Med Chem Lett. 2007 Oct 1;17(19):5349-52. | |||||
REF 70 | Potent, orally bioavailable delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-4-(5-hydroxyspiro[chromene-2,4'-pipe... J Med Chem. 2008 Oct 9;51(19):5893-6. | |||||
REF 71 | Spirocyclic delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-3-hydroxy-4-(spiro[chromene-2,4'-piperidine]-4-yl) b... J Med Chem. 2009 Sep 24;52(18):5685-702. | |||||
REF 72 | 4-Phenyl-4-[1H-imidazol-2-yl]-piperidine derivatives, a novel class of selective delta-opioid agonists. Bioorg Med Chem Lett. 2006 Jan 1;16(1):146-9. | |||||
REF 73 | Structure activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 2. Bioorg Med Chem Lett. 2007 Dec 15;17(24):6841-6. | |||||
REF 74 | Synthesis of analogues of acetylmethadol and methadol as potential narcotic antagonists. J Med Chem. 1981 Jul;24(7):903-6. | |||||
REF 75 | Hasubanan alkaloids with delta-opioid binding affinity from the aerial parts of Stephania japonica. J Nat Prod. 2010 May 28;73(5):988-91. | |||||
REF 76 | Design, synthesis, and characterization of 6beta-naltrexol analogs, and their selectivity for in vitro opioid receptor subtypes. Bioorg Med Chem Lett. 2009 May 15;19(10):2811-4. | |||||
REF 77 | Delta-opioid receptor antagonists as a new concept for central acting antitussive drugs. Pulm Pharmacol Ther. 2002;15(3):235-40. | |||||
REF 78 | SAR development of a series of 8-azabicyclo[3.2.1]octan-3-yloxy-benzamides as kappa opioid receptor antagonists. Part 2. Bioorg Med Chem Lett. 2010 Sep 15;20(18):5405-10. | |||||
REF 79 | Redefining the structure-activity relationships of 2,6-methano-3-benzazocines. Part 6: Opioid receptor binding properties of cyclic variants of 8-c... Bioorg Med Chem. 2008 May 15;16(10):5653-64. | |||||
REF 80 | Synthesis and evaluation of 3-aminopropionyl substituted fentanyl analogues for opioid activity. Bioorg Med Chem Lett. 2006 Sep 15;16(18):4946-50. | |||||
REF 81 | Novel opioid peptide derived antagonists containing (2S)-2-methyl-3-(2,6-dimethyl-4-carbamoylphenyl)propanoic acid [(2S)-Mdcp]. J Med Chem. 2008 Sep 25;51(18):5866-70. | |||||
REF 82 | Synthesis and in vitro biological evaluation of a carbon glycoside analogue of morphine-6-glucuronide. Bioorg Med Chem Lett. 2005 Mar 15;15(6):1583-6. | |||||
REF 83 | Cross-linking of human [125I]beta-endorphin to opioid receptors in rat striatal membranes: biochemical evidence for the existence of a mu/delta opioid receptor complex. J Pharmacol Exp Ther. 1990 Apr;253(1):419-26. | |||||
REF 84 | Effect of linker substitution on the binding of butorphan univalent and bivalent ligands to opioid receptors. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1507-9. | |||||
REF 85 | Development of novel enkephalin analogues that have enhanced opioid activities at both mu and delta opioid receptors. J Med Chem. 2007 Nov 1;50(22):5528-32. | |||||
REF 86 | Synthesis of stable and potent delta/mu opioid peptides: analogues of H-Tyr-c[D-Cys-Gly-Phe-D-Cys]-OH by ring-closing metathesis. J Med Chem. 2007 Jun 28;50(13):3138-42. | |||||
REF 87 | Redefining the structure-activity relationships of 2,6-methano-3-benzazocines. Part 7: syntheses and opioid receptor properties of cyclic variants ... Bioorg Med Chem Lett. 2009 Jan 15;19(2):365-8. | |||||
REF 88 | Nascent structure-activity relationship study of a diastereomeric series of kappa opioid receptor antagonists derived from CJ-15,208. Bioorg Med Chem Lett. 2009 Jul 1;19(13):3647-50. | |||||
REF 89 | Design and synthesis of conformationally constrained somatostatin analogues with high potency and specificity for mu opioid receptors. J Med Chem. 1986 Nov;29(11):2370-5. | |||||
REF 90 | Delta opioid receptor stimulation mimics ischemic preconditioning in human heart muscle. J Am Coll Cardiol. 2000 Dec;36(7):2296-302. | |||||
REF 91 | Design, synthesis, and biological evaluation of novel bifunctional C-terminal-modified peptides for delta/mu opioid receptor agonists and neurokini... J Med Chem. 2007 Jun 14;50(12):2779-86. | |||||
REF 92 | Evaluation of N-substitution in 6,7-benzomorphan compounds. Bioorg Med Chem. 2010 Jul 15;18(14):4975-82. | |||||
REF 93 | Replacement of the N-terminal tyrosine residue in opioid peptides with 3-(2,6-dimethyl-4-carbamoylphenyl)propanoic acid (Dcp) results in novel opio... J Med Chem. 2006 Aug 24;49(17):5382-5. | |||||
REF 94 | Cyclic enkephalin analogs with exceptional potency at peripheral delta opioid receptors. J Med Chem. 1994 Jan 7;37(1):146-50. | |||||
REF 95 | Role of 2',6'-dimethyl-l-tyrosine (Dmt) in some opioid lead compounds. Bioorg Med Chem. 2010 Aug 15;18(16):6024-30. | |||||
REF 96 | Conversion of the potent delta-opioid agonist H-Dmt-Tic-NH-CH(2)-bid into delta-opioid antagonists by N(1)-benzimidazole alkylation(1). J Med Chem. 2005 Dec 29;48(26):8112-4. | |||||
REF 97 | Opiate receptor binding properties of morphine-, dihydromorphine-, and codeine 6-O-sulfate ester congeners. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4291-5. | |||||
REF 98 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
REF 99 | [6-O-methyl-11C]Diprenorphine Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. | |||||
REF 100 | Bifunctional [2',6'-dimethyl-L-tyrosine1]endomorphin-2 analogues substituted at position 3 with alkylated phenylalanine derivatives yield potent mi... J Med Chem. 2007 Jun 14;50(12):2753-66. | |||||
REF 101 | Synthesis and characterization of potent and selective mu-opioid receptor antagonists, [Dmt(1), D-2-Nal(4)]endomorphin-1 (Antanal-1) and [Dmt(1), D... J Med Chem. 2007 Feb 8;50(3):512-20. | |||||
REF 102 | [3H][D-Ser2(O-tert-butyl),Leu5]enkephalyl-Thr6 and [D-Ser2(O-tert-butyl),Leu5]enkephalyl-Thr6(O-tert-butyl). Two new enkephalin analogs with both a good selectivity and a high affinity toward delta-opioid binding sites. J Biol Chem. 1988 Mar 25;263(9):4124-30. | |||||
REF 103 | Synthesis and evaluation of opioid receptor-binding affinity of elaeocarpenine and its analogs. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1601-3. | |||||
REF 104 | Synthesis and activity of endomorphin-2 and morphiceptin analogues with proline surrogates in position 2. Eur J Med Chem. 2010 Oct;45(10):4594-600. | |||||
REF 105 | New endomorphin analogues containing alicyclic beta-amino acids: influence on bioactive conformation and pharmacological profile. J Med Chem. 2008 Jul 24;51(14):4270-9. | |||||
REF 106 | Cloning and functional comparison of kappa and delta opioid receptors from mouse brain. Proc Natl Acad Sci U S A. 1993 Jul 15;90(14):6736-40. | |||||
REF 107 | Photoactivatable opiate derivatives as irreversible probes of the mu-opioid receptor. J Med Chem. 1990 Sep;33(9):2456-64. | |||||
REF 108 | Agonist-, antagonist-, and inverse agonist-regulated trafficking of the delta-opioid receptor correlates with, but does not require, G protein activation. J Pharmacol Exp Ther. 2001 Sep;298(3):1015-20. | |||||
REF 109 | Novel coumarin glycoside and phenethyl vanillate from Notopterygium forbesii and their binding affinities for opioid and dopamine receptors. Bioorg Med Chem. 2008 Mar 15;16(6):3218-23. | |||||
REF 110 | Agonist vs antagonist behavior of delta opioid peptides containing novel phenylalanine analogues in place of Tyr(1). J Med Chem. 2009 Nov 12;52(21):6941-5. | |||||
REF 111 | Opiate aromatic pharmacophore structure-activity relationships in CTAP analogues determined by topographical bias, two-dimensional NMR, and biologi... J Med Chem. 2000 Feb 24;43(4):569-80. | |||||
REF 112 | New 2',6'-dimethyl-L-tyrosine (Dmt) opioid peptidomimetics based on the Aba-Gly scaffold. Development of unique mu-opioid receptor ligands. J Med Chem. 2006 Jun 29;49(13):3990-3. | |||||
REF 113 | From the potent and selective mu opioid receptor agonist H-Dmt-d-Arg-Phe-Lys-NH(2) to the potent delta antagonist H-Dmt-Tic-Phe-Lys(Z)-OH. J Med Chem. 2005 Aug 25;48(17):5608-11. | |||||
REF 114 | Beta-methyl substitution of cyclohexylalanine in Dmt-Tic-Cha-Phe peptides results in highly potent delta opioid antagonists. J Med Chem. 2007 Jan 25;50(2):328-33. | |||||
REF 115 | Further studies on lead compounds containing the opioid pharmacophore Dmt-Tic. J Med Chem. 2008 Aug 28;51(16):5109-17. | |||||
REF 116 | Highly selective fluorescent analogue of the potent delta-opioid receptor antagonist Dmt-Tic. J Med Chem. 2004 Dec 16;47(26):6541-6. | |||||
REF 117 | Effect of lysine at C-terminus of the Dmt-Tic opioid pharmacophore. J Med Chem. 2006 Sep 7;49(18):5610-7. | |||||
REF 118 | New series of potent delta-opioid antagonists containing the H-Dmt-Tic-NH-hexyl-NH-R motif. Bioorg Med Chem Lett. 2005 Dec 15;15(24):5517-20. | |||||
REF 119 | Role of benzimidazole (Bid) in the delta-opioid agonist pseudopeptide H-Dmt-Tic-NH-CH(2)-Bid (UFP-502). Bioorg Med Chem. 2008 Mar 15;16(6):3032-8. | |||||
REF 120 | A new opioid designed multiple ligand derived from the micro opioid agonist endomorphin-2 and the delta opioid antagonist pharmacophore Dmt-Tic. Bioorg Med Chem. 2007 Nov 15;15(22):6876-81. | |||||
REF 121 | Dicarba analogues of the cyclic enkephalin peptides H-Tyr-c[D-Cys-Gly-Phe-D(or L)-Cys]NH(2) retain high opioid activity. J Med Chem. 2007 Mar 22;50(6):1414-7. | |||||
REF 122 | Conformational restriction of the phenylalanine residue in a cyclic opioid peptide analogue: effects on receptor selectivity and stereospecificity. J Med Chem. 1991 Oct;34(10):3125-32. | |||||
REF 123 | A structure-activity relationship study and combinatorial synthetic approach of C-terminal modified bifunctional peptides that are delta/mu opioid ... J Med Chem. 2008 Mar 13;51(5):1369-76. | |||||
REF 124 | Design and synthesis of novel hydrazide-linked bifunctional peptides as delta/mu opioid receptor agonists and CCK-1/CCK-2 receptor antagonists. J Med Chem. 2006 Mar 9;49(5):1773-80. | |||||
REF 125 | Partial retro-inverso, retro, and inverso modifications of hydrazide linked bifunctional peptides for opioid and cholecystokinin (CCK) receptors. J Med Chem. 2007 Jan 11;50(1):165-8. | |||||
REF 126 | Blood-brain barrier penetration by two dermorphin tetrapeptide analogues: role of lipophilicity vs structural flexibility. J Med Chem. 2008 Apr 24;51(8):2571-4. | |||||
REF 127 | The TIPP opioid peptide family: development of delta antagonists, delta agonists, and mixed mu agonist/delta antagonists. Biopolymers. 1999;51(6):411-25. | |||||
REF 128 | The effects of C-terminal modifications on the opioid activity of [N-benzylTyr(1)]dynorphin A-(1-11) analogues. J Med Chem. 2009 Nov 12;52(21):6814-21. | |||||
REF 129 | In vivo evidence for the selectivity of ICI 154129 for the delta-opioid receptor. Neuropharmacology. 1985 Feb;24(2):107-10. | |||||
REF 130 | Highly potent and selective phenylmorphan-based inverse agonists of the opioid delta receptor. J Med Chem. 2006 Sep 7;49(18):5597-609. | |||||
REF 131 | Arylacetamide kappa opioid receptor agonists with reduced cytochrome P450 2D6 inhibitory activity. Bioorg Med Chem Lett. 2005 May 16;15(10):2647-52. | |||||
REF 132 | Indolizidine alkaloids with delta-opioid receptor binding affinity from the leaves of Elaeocarpus fuscoides. J Nat Prod. 2007 May;70(5):872-5. | |||||
REF 133 | Inverse agonist action of Leu-enkephalin at delta(2)-opioid receptors mediates spinal antianalgesia. J Pharmacol Exp Ther. 2001 May;297(2):582-9. | |||||
REF 134 | Potential affinity labels for the opiate receptor based on fentanyl and related compounds. J Med Chem. 1982 Aug;25(8):913-9. | |||||
REF 135 | Lophocladines, bioactive alkaloids from the red alga Lophocladia sp. J Nat Prod. 2006 Apr;69(4):640-4. | |||||
REF 136 | 14beta-Arylpropiolylamino-17-cyclopropylmethyl-7,8-dihydronormorphinones and related opioids. Further examples of pseudoirreversible mu opioid rece... J Med Chem. 2009 Nov 12;52(21):6926-30. | |||||
REF 137 | Univalent and bivalent ligands of butorphan: characteristics of the linking chain determine the affinity and potency of such opioid ligands. J Med Chem. 2009 Dec 10;52(23):7389-96. | |||||
REF 138 | In-vitro investigation of oxazol and urea analogues of morphinan at opioid receptors. Bioorg Med Chem. 2007 Jun 15;15(12):4106-12. | |||||
REF 139 | High-affinity carbamate analogues of morphinan at opioid receptors. Bioorg Med Chem Lett. 2007 Mar 15;17(6):1508-11. | |||||
REF 140 | New opioid designed multiple ligand from Dmt-Tic and morphinan pharmacophores. J Med Chem. 2006 Sep 7;49(18):5640-3. | |||||
REF 141 | Endomorphin-1 analogs with enhanced metabolic stability and systemic analgesic activity: design, synthesis, and pharmacological characterization. Bioorg Med Chem. 2007 Feb 15;15(4):1694-702. | |||||
REF 142 | Differential antagonism of delta opioid agonists by naltrindole and its benzofuran analog (NTB) in mice: evidence for delta opioid receptor subtypes. J Pharmacol Exp Ther. 1991 May;257(2):676-80. | |||||
REF 143 | Selective in vivo binding of [3H]naltriben to delta-opioid receptors in mouse brain. Eur J Pharmacol. 1998 Jun 5;350(2-3):335-44. | |||||
REF 144 | Identification of (3R)-7-hydroxy-N-((1S)-1-[[(3R,4R)-4-(3-hydroxyphenyl)- 3,4-dimethyl-1-piperidinyl]methyl]-2-methylpropyl)-1,2,3,4-tetrahydro- 3-... J Med Chem. 2003 Jul 3;46(14):3127-37. | |||||
REF 145 | Ligand binding to nucleic acids and proteins: Does selectivity increase with strength Eur J Med Chem. 2008 Nov;43(11):2307-15. | |||||
REF 146 | Alkaloids with human delta-opioid receptor binding affinity from the Australian rainforest tree Peripentadenia mearsii. J Nat Prod. 2007 Dec;70(12):1946-50. | |||||
REF 147 | Probes for narcotic receptor mediated phenomena. 34. Synthesis and structure-activity relationships of a potent mu-agonist delta-antagonist and an ... J Med Chem. 2007 Aug 9;50(16):3765-76. | |||||
REF 148 | The antitussive activity of delta-opioid receptor stimulation in guinea pigs. J Pharmacol Exp Ther. 2000 Feb;292(2):803-9. | |||||
REF 149 | Design and synthesis of KNT-127, a -opioid receptor agonist effective by systemic administration. Bioorg Med Chem Lett. 2010 Nov 1;20(21):6302-5. | |||||
REF 150 | Nonpeptidic delta-opioid receptor agonists reduce immobility in the forced swim assay in rats. Neuropsychopharmacology. 2002 Jun;26(6):744-55. | |||||
REF 151 | Antiparkinson potential of delta-opioid receptor agonists. Eur J Pharmacol. 2000 May 19;396(2-3):101-7. | |||||
REF 152 | TIPP[psi]: a highly potent and stable pseudopeptide delta opioid receptor antagonist with extraordinary delta selectivity. J Med Chem. 1993 Oct 15;36(21):3182-7. | |||||
REF 153 | A topochemical approach to explain morphiceptin bioactivity. J Med Chem. 1993 Mar 19;36(6):708-19. | |||||
REF 154 | Endomorphin-2 with a beta-turn backbone constraint retains the potent micro-opioid receptor agonist properties. J Med Chem. 2008 Jan 10;51(1):173-7. | |||||
REF 155 | The importance of micelle-bound states for the bioactivities of bifunctional peptide derivatives for delta/mu opioid receptor agonists and neurokin... J Med Chem. 2008 Oct 23;51(20):6334-47. | |||||
REF 156 | Synthesis and pharmacological activity of deltorphin and dermorphin-related glycopeptides. J Med Chem. 1997 Aug 29;40(18):2948-52. | |||||
REF 157 | Design of cyclic deltorphins and dermenkephalins with a disulfide bridge leads to analogues with high selectivity for delta-opioid receptors. J Med Chem. 1994 Jan 7;37(1):141-5. | |||||
REF 158 | Opioid receptor binding and antinociceptive activity of the analogues of endomorphin-2 and morphiceptin with phenylalanine mimics in the position 3... Bioorg Med Chem Lett. 2006 Jul 15;16(14):3688-92. | |||||
REF 159 | Structure-activity study of endomorphin-2 analogs with C-terminal modifications by NMR spectroscopy and molecular modeling. Bioorg Med Chem. 2008 Jun 15;16(12):6415-22. | |||||
REF 160 | Characterization of [3H]naltrindole binding to delta opioid receptors in rat brain. Life Sci. 1992;50(16):PL119-24. | |||||
REF 161 | Carba-analogues of fentanyl are opioid receptor agonists. J Med Chem. 2010 Apr 8;53(7):2875-81. | |||||
REF 162 | Molecular control of Delta-opioid receptor signalling. Nature. 2014 Feb 13;506(7487):191-6. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.