Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T99799
(Former ID: TTDS00143)
|
|||||
Target Name |
Cholinesterase (BCHE)
|
|||||
Synonyms |
Pseudocholinesterase; Choline esterase II; CHE1; Butyrylcholine esterase; Acylcholine acylhydrolase
Click to Show/Hide
|
|||||
Gene Name |
BCHE
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Pain [ICD-11: MG30-MG3Z] | |||||
2 | Tonus and reflex abnormality [ICD-11: MB47] | |||||
Function |
Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters.
Click to Show/Hide
|
|||||
BioChemical Class |
Type-B carboxylesterase/lipase
|
|||||
UniProt ID | ||||||
EC Number |
EC 3.1.1.8
|
|||||
Sequence |
MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIP
YAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDC LYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALG FLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPG SHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEI LLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVNKDEGTAFLVY GAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDV VGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLER RDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMT KLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCV GL Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
ADReCS ID | BADD_A00300 ; BADD_A00362 ; BADD_A01261 ; BADD_A01322 ; BADD_A02053 ; BADD_A04623 | |||||
HIT2.0 ID | T25Y64 |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 2 Approved Drugs | + | ||||
1 | Hexafluronium bromide | Drug Info | Approved | Spasm | [2], [3] | |
2 | MEPTAZINOL | Drug Info | Approved | Pain | [2] | |
Clinical Trial Drug(s) | [+] 6 Clinical Trial Drugs | + | ||||
1 | (-)-Phenserine | Drug Info | Phase 3 | Alzheimer disease | [4] | |
2 | Eptastigmine | Drug Info | Phase 3 | Cognitive impairment | [5] | |
3 | JES-9501 | Drug Info | Phase 1 | Alzheimer disease | [6] | |
4 | Plasma derived human butyrylcholinesterase | Drug Info | Phase 1 | Neurotoxicity | [7] | |
5 | Protexia | Drug Info | Phase 1 | Alzheimer disease | [8] | |
6 | RVT-103+RVT-104 | Drug Info | Phase 1 | Alzheimer disease | [9] | |
Mode of Action | [+] 3 Modes of Action | + | ||||
Inhibitor | [+] 233 Inhibitor drugs | + | ||||
1 | Hexafluronium bromide | Drug Info | [1] | |||
2 | MEPTAZINOL | Drug Info | [10] | |||
3 | (-)-Phenserine | Drug Info | [11] | |||
4 | Eptastigmine | Drug Info | [12] | |||
5 | RVT-103+RVT-104 | Drug Info | [9] | |||
6 | Decyle nelycorine dibromo salt derivative 1 | Drug Info | [15] | |||
7 | Di-substituted piperidine derivative 1 | Drug Info | [15] | |||
8 | Di-substituted piperidine derivative 2 | Drug Info | [15] | |||
9 | Di-substituted piperidine derivative 3 | Drug Info | [15] | |||
10 | Egonol compound 1 | Drug Info | [16] | |||
11 | Indoline derivative 1 | Drug Info | [15] | |||
12 | Isochroman-4-ketone derivative 1 | Drug Info | [15] | |||
13 | PMID29757691-Compound-10 | Drug Info | [15] | |||
14 | PMID29757691-Compound-2a | Drug Info | [15] | |||
15 | PMID29757691-Compound-2a-i | Drug Info | [15] | |||
16 | PMID29757691-Compound-7 | Drug Info | [15] | |||
17 | PMID29757691-Compound-8a | Drug Info | [15] | |||
18 | PMID29757691-Compound-8b | Drug Info | [15] | |||
19 | PMID29757691-Compound-8c | Drug Info | [15] | |||
20 | PMID29757691-Compound-8d | Drug Info | [15] | |||
21 | Quinazoline alkaloid derivative 1 | Drug Info | [15] | |||
22 | Tacrine heterodimer derivative 1 | Drug Info | [15] | |||
23 | Tetra-hydro-isoquinoline derivative 1 | Drug Info | [15] | |||
24 | Tetra-hydro-isoquinoline derivative 2 | Drug Info | [15] | |||
25 | Tetra-hydro-isoquinoline derivative 3 | Drug Info | [15] | |||
26 | Tetra-hydro-isoquinoline derivative 4 | Drug Info | [15] | |||
27 | (-)-DEBROMOFLUSTRAMINE B | Drug Info | [17] | |||
28 | (-)-Phenethylcymserine | Drug Info | [11] | |||
29 | (-)-Tolserine | Drug Info | [11] | |||
30 | (1'H-Phenothiazin-1'-yl)(piperidin-1-yl)methanone | Drug Info | [18] | |||
31 | (10H-phenothiazin-10-yl)(m-tolyl)methanone | Drug Info | [19] | |||
32 | (10H-phenothiazin-10-yl)(o-tolyl)methanone | Drug Info | [19] | |||
33 | (10H-phenothiazin-10-yl)(p-tolyl)methanone | Drug Info | [19] | |||
34 | (10H-phenothiazin-10-yl)(phenyl)methanone | Drug Info | [19] | |||
35 | (1R)-MENTHYL HEXYL PHOSPHONATE GROUP | Drug Info | [20] | |||
36 | (1S)-MENTHYL HEXYL PHOSPHONATE GROUP | Drug Info | [20] | |||
37 | (24S)-ethylcholesta-7,9(11),22(E)-triene-3b-ol | Drug Info | [21] | |||
38 | (3-bromophenyl)(10H-phenothiazin-10-yl)methanone | Drug Info | [19] | |||
39 | (4-bromophenyl)(10H-phenothiazin-10-yl)methanone | Drug Info | [19] | |||
40 | (4-nitrophenyl)(10H-phenothiazin-10-yl)methanone | Drug Info | [19] | |||
41 | (RS)-tacrine(10)-hupyridone | Drug Info | [22] | |||
42 | 1,10-bis(pyridinium)-decane dibromide | Drug Info | [23] | |||
43 | 1,11-bis(pyridinium)-undecane dibromide | Drug Info | [23] | |||
44 | 1,2-bis(2,3-fluorophenyl)ethane-1,2-dione | Drug Info | [24] | |||
45 | 1,2-di(10H-phenothiazin-10-yl)ethane-1,2-dione | Drug Info | [19] | |||
46 | 1,2-Di(berberine-9-O-yl)ethane dibromide | Drug Info | [25] | |||
47 | 1,2-indanedione | Drug Info | [26] | |||
48 | 1,2-NAPHTHOQUINONE | Drug Info | [26] | |||
49 | 1,3-Di(berberine-9-O-yl)ethane dibromide | Drug Info | [25] | |||
50 | 1,4-Di(berberine-9-O-yl)ethane dibromide | Drug Info | [25] | |||
51 | 1,9-bis(pyridinium)-nonane dibromide | Drug Info | [23] | |||
52 | 1-(10H-phenothiazin-10-yl)-2-phenylbutan-1-one | Drug Info | [19] | |||
53 | 1-(10H-phenothiazin-10-yl)-2-phenylethanone | Drug Info | [19] | |||
54 | 1-(10H-phenothiazin-10-yl)-2-phenylpropan-1-one | Drug Info | [19] | |||
55 | 1-(10H-phenothiazin-10-yl)-3-phenylbutan-1-one | Drug Info | [19] | |||
56 | 1-(10H-phenothiazin-10-yl)-3-phenylpropan-1-one | Drug Info | [19] | |||
57 | 1-(10H-phenothiazin-10-yl)-4-phenylbutan-1-one | Drug Info | [19] | |||
58 | 1-(3,4-dichlorobenzyl)-1H-indole-2,3-dione | Drug Info | [27] | |||
59 | 1-methyl-3-(phenylcarbamoyloxy)pyridinium bromide | Drug Info | [11] | |||
60 | 2,3-dihydropyrrolo[2,1-b]quinazolin-9(1H)-imine | Drug Info | [28] | |||
61 | 2-(N-Morpholino)-Ethanesulfonic Acid | Drug Info | [29] | |||
62 | 2-biphenyl-4-yl-1-phenothiazin-10-yl-ethanone | Drug Info | [19] | |||
63 | 2-methoxyphenyl 10H-phenothiazine-10-carboxylate | Drug Info | [30] | |||
64 | 2-Methyl-beta-carboline-2-ium iodide | Drug Info | [31] | |||
65 | 2-Propyl-beta-carboline-2-ium iodide | Drug Info | [31] | |||
66 | 24-ethyl-cholest-7-ene-3,5,6-triol | Drug Info | [21] | |||
67 | 24-ethylcholest-6-ene-3,5-diol | Drug Info | [21] | |||
68 | 3,4,5,6-Tetrachloro-[1,2]benzoquinone | Drug Info | [32] | |||
69 | 3-(2-Diethylamino-acetamino)-rutaecarpine | Drug Info | [33] | |||
70 | 3-(2-Diethylamino-propionamino)-rutaecarpine | Drug Info | [33] | |||
71 | 3-(2-N-Piperidyl-propionamino)-rutaecarpine | Drug Info | [33] | |||
72 | 3-(2-N-Pyrrolyl-acetamino)-rutaecarpine | Drug Info | [33] | |||
73 | 3-(2-N-Pyrrolyl-propionamino)-rutaecarpine | Drug Info | [33] | |||
74 | 3-(dimethylamino)phenyl phenylcarbamate | Drug Info | [11] | |||
75 | 3-chlorophenyl 10H-phenothiazine-10-carboxylate | Drug Info | [30] | |||
76 | 3-isopr-sal-cyclosal-d4TMP | Drug Info | [34] | |||
77 | 3-methoxyphenyl 10H-phenothiazine-10-carboxylate | Drug Info | [30] | |||
78 | 3-phenyl-cyclosal-d4TMP | Drug Info | [34] | |||
79 | 3-sal-cyclosal-d4TMP | Drug Info | [34] | |||
80 | 3-[10-(benzylmethylamino)decyloxy]xanthen-9-one | Drug Info | [35] | |||
81 | 3-[11-(benzylmethylamino)undecyloxy]xanthen-9-one | Drug Info | [35] | |||
82 | 3-[12-(benzylmethylamino)dodecyloxy]xanthen-9-one | Drug Info | [35] | |||
83 | 3-[3-(benzylmethylamino)propoxy]xanthen-9-one | Drug Info | [35] | |||
84 | 3-[4-(benzylmethylamino)butoxy]xanthen-9-one | Drug Info | [35] | |||
85 | 3-[5-(benzylmethylamino)pentyloxy]xanthen-9-one | Drug Info | [35] | |||
86 | 3-[6-(benzylmethylamino)hexyloxy]xanthen-9-one | Drug Info | [35] | |||
87 | 3-[7-(benzylmethylamino)-heptyloxy]xanthen-9-one | Drug Info | [35] | |||
88 | 3-[8-(benzylmethylamino)octyloxy]xanthen-9-one | Drug Info | [35] | |||
89 | 3-[9-(benzylmethylamino)nonyloxy]xanthen-9-one | Drug Info | [35] | |||
90 | 4-chlorophenyl 10H-phenothiazine-10-carboxylate | Drug Info | [30] | |||
91 | 4-ISOPROPYLPHENSERINE | Drug Info | [36], [37] | |||
92 | 4-methoxyphenyl 10H-phenothiazine-10-carboxylate | Drug Info | [30] | |||
93 | 4-[4-(benzyloxy)piperidino]butyl benzoate | Drug Info | [38] | |||
94 | 4-[4-(benzyloxy)piperidino]butyl-3-chlorobenzoate | Drug Info | [38] | |||
95 | 4-[4-(benzyloxy)piperidino]butyl-3-fluorobenzoate | Drug Info | [38] | |||
96 | 4-[4-(benzyloxy)piperidino]butyl-4-chlorobenzoate | Drug Info | [38] | |||
97 | 4-[4-(benzyloxy)piperidino]butyl-4-fluorobenzoate | Drug Info | [38] | |||
98 | 4-[4-(benzyloxy)piperidino]butyl-4-nitrobenzoate | Drug Info | [38] | |||
99 | 5,6-dinitroacenaphthoquinone | Drug Info | [26] | |||
100 | 5-methyl-cyclosal-d4TMP | Drug Info | [34] | |||
101 | 6-chlorotacrine hydrochloride | Drug Info | [39] | |||
102 | 6-hydroxy-1,2,9-trimethyl-9H-beta-carbolin-2-ium | Drug Info | [40] | |||
103 | 6-hydroxy-1,2-dimethyl-9H-beta-carbolin-2-ium | Drug Info | [40] | |||
104 | 6-hydroxy-2-methyl-9H-beta-carbolin-2-ium | Drug Info | [40] | |||
105 | 6-methoxy-1,2-dimethyl-9H-beta-carbolin-2-ium | Drug Info | [40] | |||
106 | 6-methoxy-1,9-dimethyl-9H-pyrido[3,4-b]indole | Drug Info | [40] | |||
107 | 6-methoxy-2-methyl-9H-beta-carbolin-2-ium | Drug Info | [40] | |||
108 | 7-Oxo-7H-dibenzo[de,g]quinoline | Drug Info | [41] | |||
109 | 9-(3-IODOBENZYLAMINO)-1,2,3,4-TETRAHYDROACRIDINE | Drug Info | [20] | |||
110 | 9-Ethyl-2-methyl-beta-carboline-2-ium iodide | Drug Info | [31] | |||
111 | 9-N-Phenylmethylamino-Tacrine | Drug Info | [29] | |||
112 | 9-O-[2-(Phenylol-1-yloxy)ethyl]berberine bromide | Drug Info | [42] | |||
113 | 9-O-[2-(Phenylol-1-yloxy)hexyl]berberine bromide | Drug Info | [42] | |||
114 | 9-O-[3-(2-Pyridinoxyl)butyl]-berberine bromide | Drug Info | [25] | |||
115 | 9-O-[3-(4-Bromo-phenoxyl)butyl]-berberine bromide | Drug Info | [25] | |||
116 | 9-O-[3-(4-Nitro-phenoxyl)butyl]-berberine bromide | Drug Info | [25] | |||
117 | 9-O-[3-(Phenylamino)propyl]-berberine bromide | Drug Info | [25] | |||
118 | 9-O-[3-(Phenylol-1-yloxy)propyl]berberine bromide | Drug Info | [42] | |||
119 | 9-O-[4-(Phenylol-1-yloxy)butyl]berberine bromide | Drug Info | [42] | |||
120 | 9-O-[5-(Phenylol-1-yloxy)pentyl]berberine bromide | Drug Info | [42] | |||
121 | 9-[5-(beta-Carboline-9-yl)pentyl]-beta-carboline | Drug Info | [31] | |||
122 | 9-[9-(beta-Carboline-9-yl)nonyl]-beta-carboline | Drug Info | [31] | |||
123 | ACENAPHTHOQUINONE | Drug Info | [26] | |||
124 | Alpha-D-Mannose | Drug Info | [29] | |||
125 | Anthracen-10-yl(10H-phenothiazin-10-yl)methanone | Drug Info | [19] | |||
126 | AS-1397 | Drug Info | [43] | |||
127 | BENZOQUINONE | Drug Info | [32] | |||
128 | Beta-D-Mannose | Drug Info | [29] | |||
129 | Bis-7-tacrine | Drug Info | [44] | |||
130 | Bis-cyclosal-d4TMP | Drug Info | [34] | |||
131 | Butanoic Acid | Drug Info | [29] | |||
132 | Butyl 10H-phenothiazine-10-carboxylate | Drug Info | [30] | |||
133 | Butyrylthiocholine | Drug Info | [45] | |||
134 | CAPROCTAMINE | Drug Info | [46] | |||
135 | CHF-2819 | Drug Info | [47] | |||
136 | CHLORANIL | Drug Info | [32] | |||
137 | Cyclopentyl 10H-phenothiazine-10-carboxylate | Drug Info | [30] | |||
138 | Cyclosal-d4TMP | Drug Info | [34] | |||
139 | DEMETHYLDEBROMOFLUSTRAMINE B | Drug Info | [17] | |||
140 | Diethylphosphono Group | Drug Info | [29] | |||
141 | Dodecanesulfonate ion | Drug Info | [20] | |||
142 | Ethyl Dihydrogen Phosphate | Drug Info | [29] | |||
143 | ETHYL HYDROGEN DIETHYLAMIDOPHOSPHATE | Drug Info | [20] | |||
144 | Fucose | Drug Info | [29] | |||
145 | HALOXYSTEROL A | Drug Info | [21] | |||
146 | HALOXYSTEROL B | Drug Info | [21] | |||
147 | Haloxysterol C | Drug Info | [21] | |||
148 | Haloxysterol D | Drug Info | [21] | |||
149 | Huprine X | Drug Info | [48] | |||
150 | Huprine-Tacrine Heterodimer | Drug Info | [49] | |||
151 | Iso-OMPA | Drug Info | [50] | |||
152 | Isopropyl 10H-phenothiazine-10-carboxylate | Drug Info | [30] | |||
153 | Isosorbide-2-(benzylcarbamate)-5-benzoate | Drug Info | [50] | |||
154 | Isosorbide-2-(benzylcarbamate)-5-mononitrate | Drug Info | [50] | |||
155 | Isosorbide-2-(butylcarbamate)-5-benzoate | Drug Info | [50] | |||
156 | Isosorbide-2-(butylcarbamate)-5-mononitrate | Drug Info | [50] | |||
157 | Isosorbide-2-(cyclohexylcarbamate)-5-mononitrate | Drug Info | [50] | |||
158 | Isosorbide-2-(ethylcarbamate)-5-mononitrate | Drug Info | [50] | |||
159 | Isosorbide-2-(methylcarbamate)-5-benzoate | Drug Info | [50] | |||
160 | Isosorbide-2-(methylcarbamate)-5-mononitrate | Drug Info | [50] | |||
161 | Isosorbide-2-(propylcarbamate)-5-mononitrate | Drug Info | [50] | |||
162 | Isosorbide-2-benzyl carbamate | Drug Info | [51] | |||
163 | Isosorbide-2-benzylcarbamate-5-(o-toluate) | Drug Info | [51] | |||
164 | Isosorbide-2-benzylcarbamate-5-acetate | Drug Info | [50] | |||
165 | Isosorbide-2-benzylcarbamate-5-cyclopentanoate | Drug Info | [50] | |||
166 | Isosorbide-2-benzylcarbamate-5-cyclopropanoate | Drug Info | [50] | |||
167 | Isosorbide-2-benzylcarbamate-5-isonicotinate | Drug Info | [50] | |||
168 | Isosorbide-2-benzylcarbamate-5-nicotinate | Drug Info | [50] | |||
169 | Isosorbide-2-benzylcarbamate-5-pentanoate | Drug Info | [50] | |||
170 | Isosorbide-2-benzylcarbamate-5-propionate | Drug Info | [50] | |||
171 | Isosorbide-2-benzylcarbamate-5-triflate | Drug Info | [50] | |||
172 | Isosorbide-di-(benzylcarbamate) | Drug Info | [52] | |||
173 | Isosorbide-di-(butylcarbamate) | Drug Info | [52] | |||
174 | Isosorbide-di-(ethylcarbamate) | Drug Info | [52] | |||
175 | Isosorbide-di-(propylcarbamate) | Drug Info | [52] | |||
176 | LAWSARITOL | Drug Info | [21] | |||
177 | LIPOCRINE | Drug Info | [53] | |||
178 | M-tolyl 10H-phenothiazine-10-carboxylate | Drug Info | [30] | |||
179 | MEMOQUIN | Drug Info | [53] | |||
180 | Methyl 10H-phenothiazine-10-carboxylate | Drug Info | [30] | |||
181 | Methyl Phosphinic Acid | Drug Info | [29] | |||
182 | MF-8623 | Drug Info | [36] | |||
183 | Monoisopropyl Ester Phosphonic Acid Group | Drug Info | [29] | |||
184 | Morpholino(1'H-phenothiazin-1'-yl)methanone | Drug Info | [18] | |||
185 | N,N'-(1',10'-decylene)-bis-(-)-nor-MEP | Drug Info | [10] | |||
186 | N,N'-(1',11'-undecydene)-bis-(-)-nor-MEP | Drug Info | [10] | |||
187 | N,N'-(1',12'-dodecydene)-bis-(-)-nor-MEP | Drug Info | [10] | |||
188 | N,N'-(1',2'-ethylene)-bis-(-)-nor-MEP | Drug Info | [10] | |||
189 | N,N'-(1',3'-propylene)-bis-(-)-nor-MEP | Drug Info | [10] | |||
190 | N,N'-(1',4'-butylene)-bis-(-)-nor-MEP | Drug Info | [10] | |||
191 | N,N'-(1',5'-pentylene)-bis-(-)-nor-MEP | Drug Info | [10] | |||
192 | N,N'-(1',6-hexylene)-bis-(-)-nor-MEP | Drug Info | [10] | |||
193 | N,N'-(1',7'-heptylene)-bis-(-)-nor-MEP | Drug Info | [10] | |||
194 | N,N'-(1',8'-octylene)-bis-(-)-nor-MEP | Drug Info | [10] | |||
195 | N,N'-(1',9'-nonylene)-bis-(-)-nor-MEP | Drug Info | [10] | |||
196 | N,N-Diethyl-1'H-phenothiazine-1'-carboxamide | Drug Info | [18] | |||
197 | N,N-Diisopropyl-1'H-phenothiazine-1'-carboxamide | Drug Info | [18] | |||
198 | N,N-Dimethyl-1'H-phenothiazine-1'-carboxamide | Drug Info | [18] | |||
199 | N,N-Dipropyl-1'H-phenothiazine-1'-carboxamide | Drug Info | [18] | |||
200 | N-(Adamant-1-yl)-1'H-phenothiazine-1'-carboxamide | Drug Info | [18] | |||
201 | N-Benzyl-1'H-phenothiazine-1'-carboxamide | Drug Info | [18] | |||
202 | N-benzyl-2-thiomorpholinopyrimidin-4-amine | Drug Info | [44] | |||
203 | N-Cyclobutyl-1'H-phenothiazine-1'-carboxamide | Drug Info | [18] | |||
204 | N-Cyclohexyl-1'H-phenothiazine-1'-carboxamide | Drug Info | [18] | |||
205 | N-Cyclopentyl-1'H-phenothiazine-1'-carboxamide | Drug Info | [18] | |||
206 | N-Isopropyl-1'H-phenothiazine-1'-carboxamide | Drug Info | [18] | |||
207 | N-Methyl-1'H-phenothiazine-1'-carboxamide | Drug Info | [18] | |||
208 | N-n-heptyl-7-methoxytacrine hydrochloride | Drug Info | [54] | |||
209 | N-n-hexyl-7-methoxytacrine hydrochloride | Drug Info | [54] | |||
210 | N-n-nonyl-7-methoxytacrine hydrochloride | Drug Info | [54] | |||
211 | N-n-octyl-7-methoxytacrine hydrochloride | Drug Info | [54] | |||
212 | N-n-pentyl-7-methoxytacrine hydrochloride | Drug Info | [54] | |||
213 | N-Neopentyl-1'H-phenothiazine-1'-carboxamide | Drug Info | [18] | |||
214 | N-o-Tolyl-1'H-phenothiazine-1'-carboxamide | Drug Info | [18] | |||
215 | N-p-Tolyl-1'H-phenothiazine-1'-carboxamide | Drug Info | [18] | |||
216 | N-phenethyl-2-(pyrrolidin-1-yl)pyrimidin-4-amine | Drug Info | [44] | |||
217 | N-Phenyl-1'H-phenothiazine-1'-carboxamide | Drug Info | [18] | |||
218 | N-tert-Butyl-1'H-phenothiazine-1'-carboxamide | Drug Info | [18] | |||
219 | Naphthalen-1-yl 10H-phenothiazine-10-carboxylate | Drug Info | [30] | |||
220 | Naphthalen-1-yl(10H-phenothiazin-10-yl)methanone | Drug Info | [19] | |||
221 | Naphthalen-2-yl 10H-phenothiazine-10-carboxylate | Drug Info | [30] | |||
222 | Naphthalen-2-yl(10H-phenothiazin-10-yl)methanone | Drug Info | [19] | |||
223 | NOSTOCARBOLINE | Drug Info | [56] | |||
224 | NP-0336 | Drug Info | [55] | |||
225 | NSC-23180 | Drug Info | [26] | |||
226 | O-tolyl 10H-phenothiazine-10-carboxylate | Drug Info | [30] | |||
227 | P-tolyl 10H-phenothiazine-10-carboxylate | Drug Info | [30] | |||
228 | Phenanthrene-9,10-dione | Drug Info | [26] | |||
229 | Phenyl 10H-phenothiazine-10-carboxylate | Drug Info | [30] | |||
230 | Tert-butyl 10H-phenothiazine-10-carboxylate | Drug Info | [30] | |||
231 | TOLSERINE | Drug Info | [12] | |||
232 | VAGANINE D | Drug Info | [57] | |||
233 | XANTHOSTIGMINE | Drug Info | [58] | |||
Modulator | [+] 5 Modulator drugs | + | ||||
1 | JES-9501 | Drug Info | [6] | |||
2 | Plasma derived human butyrylcholinesterase | Drug Info | [13] | |||
3 | Protexia | Drug Info | [14] | |||
4 | Non-PEGylated butyrylcholinesterase | Drug Info | [55] | |||
5 | Recombinant human butyrylcholinesterase | Drug Info | [55] | |||
Reactivator | [+] 1 Reactivator drugs | + | ||||
1 | Oxime derivative 1 | Drug Info | [15] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Drug Binding Sites of Target | Top | |||||
---|---|---|---|---|---|---|
Ligand Name: Tacrine | Ligand Info | |||||
Structure Description | Human butyrylcholinesterase in complex with tacrine | PDB:4BDS | ||||
Method | X-ray diffraction | Resolution | 2.10 Å | Mutation | Yes | [59] |
PDB Sequence |
IIIATKNGKV
13 RGMQLTVFGG23 TVTAFLGIPY33 AQPPLGRLRF43 KKPQSLTKWS53 DIWNATKYAN 63 SCCQNIDQSF73 PGFHGSEMWN83 PNTDLSEDCL93 YLNVWIPAPK103 PKNATVLIWI 113 YGGGFQTGTS123 SLHVYDGKFL133 ARVERVIVVS143 MNYRVGALGF153 LALPGNPEAP 163 GNMGLFDQQL173 ALQWVQKNIA183 AFGGNPKSVT193 LFGESAGAAS203 VSLHLLSPGS 213 HSLFTRAILQ223 SGSFNAPWAV233 TSLYEARNRT243 LNLAKLTGCS253 RENETEIIKC 263 LRNKDPQEIL273 LNEAFVVPYG283 TPLSVNFGPT293 VDGDFLTDMP303 DILLELGQFK 313 KTQILVGVNK323 DEGTAFLVYG333 APGFSKDNNS343 IITRKEFQEG353 LKIFFPGVSE 363 FGKESILFHY373 TDWVQRPENY385 REALGDVVGD395 YNFICPALEF405 TKKFSEWGNN 415 AFFYYFEHRS425 SKLPWPEWMG435 VMHGYEIEFV445 FGLPLERRDQ455 YTKAEEILSR 465 SIVKRWANFA475 KYGNPQETQN485 QSTSWPVFKS495 TEQKYLTLNT505 ESTRIMTKLR 515 AQQCRFWTSF525 FPKV
|
|||||
|
||||||
Ligand Name: Beta-L-fucose | Ligand Info | |||||
Structure Description | Human Butyrylcholinesterase complexed with N-Propargyliperidines | PDB:5LKR | ||||
Method | X-ray diffraction | Resolution | 2.52 Å | Mutation | No | [60] |
PDB Sequence |
DIIIATKNGK
12 VRGMNLTVFG22 GTVTAFLGIP32 YAQPPLGRLR42 FKKPQSLTKW52 SDIWNATKYA 62 NSCCQNIDQS72 FPGFHGSEMW82 NPNTDLSEDC92 LYLNVWIPAP102 KPKNATVLIW 112 IYGGGFQTGT122 SSLHVYDGKF132 LARVERVIVV142 SMNYRVGALG152 FLALPGNPEA 162 PGNMGLFDQQ172 LALQWVQKNI182 AAFGGNPKSV192 TLFGESAGAA202 SVSLHLLSPG 212 SHSLFTRAIL222 QSGSFNAPWA232 VTSLYEARNR242 TLNLAKLTGC252 SRENETEIIK 262 CLRNKDPQEI272 LLNEAFVVPY282 GTPLSVNFGP292 TVDGDFLTDM302 PDILLELGQF 312 KKTQILVGVN322 KDEGTAFLVY332 GAPGFSKDNN342 SIITRKEFQE352 GLKIFFPGVS 362 EFGKESILFH372 YTDWVDDQRP382 ENYREALGDV392 VGDYNFICPA402 LEFTKKFSEW 412 GNNAFFYYFE422 HRSSKLPWPE432 WMGVMHGYEI442 EFVFGLPLER452 RDNYTKAEEI 462 LSRSIVKRWA472 NFAKYGNPNE482 TQNNSTSWPV492 FKSTEQKYLT502 LNTESTRIMT 512 KLRAQQCRFW522 TSFFPKVL
|
|||||
|
||||||
Click to View More Binding Site Information of This Target and Ligand Pair | ||||||
Click to View More Binding Site Information of This Target with Different Ligands |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Tissue Distribution
of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.
The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects
(Nat Rev Drug Discov, 20: 64-81, 2021).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Tissue Distribution
Biological Network Descriptors
|
Protein Name | Pfam ID | Percentage of Identity (%) | E value |
---|---|---|---|
Arylacetamide deacetylase (AADAC) | 31.707 (39/123) | 3.72E-05 |
Note:
If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.
|
Degree | 1 | Degree centrality | 1.07E-04 | Betweenness centrality | 0.00E+00 |
---|---|---|---|---|---|
Closeness centrality | 1.71E-01 | Radiality | 1.27E+01 | Clustering coefficient | 0.00E+00 |
Neighborhood connectivity | 1.30E+01 | Topological coefficient | 1.00E+00 | Eccentricity | 13 |
Download | Click to Download the Full PPI Network of This Target | ||||
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
Panther Pathway | [+] 3 Panther Pathways | + | ||||
1 | Muscarinic acetylcholine receptor 1 and 3 signaling pathway | |||||
2 | Muscarinic acetylcholine receptor 2 and 4 signaling pathway | |||||
3 | Nicotinic acetylcholine receptor signaling pathway | |||||
WikiPathways | [+] 1 WikiPathways | + | ||||
1 | Irinotecan Pathway |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Synergistic effect of acidosis and succinylcholine-induced hyperkalemia in spinal cord transected rats. Acta Anaesthesiol Scand. 1984 Feb;28(1):87-90. | |||||
REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 3 | Pharmacology, clinical uses, and adverse effects of ceruletide, a cholecystokinetic agent. Pharmacotherapy. 1982 Jul-Aug;2(4):223-34. | |||||
REF 4 | Neurotrophic and neuroprotective actions of (-)- and (+)-phenserine, candidate drugs for Alzheimer's disease. PLoS One. 2013;8(1):e54887. | |||||
REF 5 | Eptastigmine: ten years of pharmacology, toxicology, pharmacokinetic, and clinical studies. CNS Drug Rev. 2001 Winter;7(4):369-86. | |||||
REF 6 | Dehydroevodiamine attenuates beta-amyloid peptide-induced amnesia in mice. Eur J Pharmacol. 2001 Feb 16;413(2-3):221-5. | |||||
REF 7 | ClinicalTrials.gov (NCT00333528) A Study of Plasma-Derived Human Butyrylcholinesterase Administered Intramuscularly. U.S. National Institutes of Health. | |||||
REF 8 | ClinicalTrials.gov (NCT00744146) First Time in Human Study of Protexia. U.S. National Institutes of Health. | |||||
REF 9 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 10 | Bis-(-)-nor-meptazinols as novel nanomolar cholinesterase inhibitors with high inhibitory potency on amyloid-beta aggregation. J Med Chem. 2008 Apr 10;51(7):2027-36. | |||||
REF 11 | Long-acting anticholinesterases for myasthenia gravis: synthesis and activities of quaternary phenylcarbamates of neostigmine, pyridostigmine and physostigmine. Bioorg Med Chem. 2010 Jul 1;18(13):4687-93. | |||||
REF 12 | Inhibition of human acetyl- and butyrylcholinesterase by novel carbamates of (-)- and (+)-tetrahydrofurobenzofuran and methanobenzodioxepine. J Med Chem. 2006 Apr 6;49(7):2174-85. | |||||
REF 13 | Acetylcholinesterase-Fc Fusion Protein (AChE-Fc): A Novel Potential Organophosphate Bioscavenger with Extended Plasma Half-Life. Bioconjug Chem. 2015 Aug 19;26(8):1753-8. | |||||
REF 14 | In vitro and in vivo characterization of recombinant human butyrylcholinesterase (Protexia) as a potential nerve agent bioscavenger. Chem Biol Interact. 2005 Dec 15;157-158:363-5. | |||||
REF 15 | A patent review of butyrylcholinesterase inhibitors and reactivators 2010-2017.Expert Opin Ther Pat. 2018 Jun;28(6):455-465. | |||||
REF 16 | Recent advances in acetylcholinesterase Inhibitors and Reactivators: an update on the patent literature (2012-2015).Expert Opin Ther Pat. 2017 Apr;27(4):455-476. | |||||
REF 17 | Synthesis and biological evaluation of (-)- and (+)-debromoflustramine B and its analogues as selective butyrylcholinesterase inhibitors. J Med Chem. 2008 Sep 11;51(17):5271-84. | |||||
REF 18 | Differential binding of phenothiazine urea derivatives to wild-type human cholinesterases and butyrylcholinesterase mutants. Bioorg Med Chem. 2010 Mar 15;18(6):2232-2244. | |||||
REF 19 | Selective reversible inhibition of human butyrylcholinesterase by aryl amide derivatives of phenothiazine. Bioorg Med Chem. 2007 Oct 1;15(19):6367-78. | |||||
REF 20 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
REF 21 | Isolation and cholinesterase-inhibition studies of sterols from Haloxylon recurvum. Bioorg Med Chem Lett. 2006 Feb;16(3):573-80. | |||||
REF 22 | Exploiting protein fluctuations at the active-site gorge of human cholinesterases: further optimization of the design strategy to develop extremely... J Med Chem. 2008 Jun 12;51(11):3154-70. | |||||
REF 23 | Preparation and in vitro screening of symmetrical bispyridinium cholinesterase inhibitors bearing different connecting linkage-initial study for My... Bioorg Med Chem Lett. 2010 Mar 1;20(5):1763-6. | |||||
REF 24 | Analysis of the inhibition of mammalian carboxylesterases by novel fluorobenzoins and fluorobenzils. Bioorg Med Chem. 2007 Jun 1;15(11):3801-17. | |||||
REF 25 | Synthesis and biological evaluation of a new series of berberine derivatives as dual inhibitors of acetylcholinesterase and butyrylcholinesterase. Bioorg Med Chem. 2010 Jun 15;18(12):4475-84. | |||||
REF 26 | Planarity and constraint of the carbonyl groups in 1,2-diones are determinants for selective inhibition of human carboxylesterase 1. J Med Chem. 2007 Nov 15;50(23):5727-34. | |||||
REF 27 | Selective inhibition of carboxylesterases by isatins, indole-2,3-diones. J Med Chem. 2007 Apr 19;50(8):1876-85. | |||||
REF 28 | Homobivalent quinazolinimines as novel nanomolar inhibitors of cholinesterases with dirigible selectivity toward butyrylcholinesterase. J Med Chem. 2006 Sep 7;49(18):5411-3. | |||||
REF 29 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
REF 30 | Carbamates with differential mechanism of inhibition toward acetylcholinesterase and butyrylcholinesterase. J Med Chem. 2008 Jul 24;51(14):4200-12. | |||||
REF 31 | Bivalent beta-carbolines as potential multitarget anti-Alzheimer agents. J Med Chem. 2010 May 13;53(9):3611-7. | |||||
REF 32 | Identification and characterization of novel benzil (diphenylethane-1,2-dione) analogues as inhibitors of mammalian carboxylesterases. J Med Chem. 2005 Apr 21;48(8):2906-15. | |||||
REF 33 | Synthesis and evaluation of novel rutaecarpine derivatives and related alkaloids derivatives as selective acetylcholinesterase inhibitors. Eur J Med Chem. 2010 Apr;45(4):1415-23. | |||||
REF 34 | Bis-cycloSal-d4T-monophosphates: drugs that deliver two molecules of bioactive nucleotides. J Med Chem. 2007 Mar 22;50(6):1335-46. | |||||
REF 35 | Cholinesterase inhibitors: SAR and enzyme inhibitory activity of 3-[omega-(benzylmethylamino)alkoxy]xanthen-9-ones. Bioorg Med Chem. 2007 Jan 1;15(1):575-85. | |||||
REF 36 | A new therapeutic target in Alzheimer's disease treatment: attention to butyrylcholinesterase. Curr Med Res Opin. 2001;17(3):159-65. | |||||
REF 37 | Design, synthesis, evaluation and QSAR analysis of N(1)-substituted norcymserine derivatives as selective butyrylcholinesterase inhibitors. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1718-20. | |||||
REF 38 | Synthesis, in vitro assay, and molecular modeling of new piperidine derivatives having dual inhibitory potency against acetylcholinesterase and Abe... Bioorg Med Chem. 2007 Oct 15;15(20):6596-607. | |||||
REF 39 | Pyrano[3,2-c]quinoline-6-chlorotacrine hybrids as a novel family of acetylcholinesterase- and beta-amyloid-directed anti-Alzheimer compounds. J Med Chem. 2009 Sep 10;52(17):5365-79. | |||||
REF 40 | 6-Hydroxy- and 6-methoxy-beta-carbolines as acetyl- and butyrylcholinesterase inhibitors. Bioorg Med Chem Lett. 2006 Nov 15;16(22):5840-3. | |||||
REF 41 | Synthesis, biological evaluation and molecular modeling of oxoisoaporphine and oxoaporphine derivatives as new dual inhibitors of acetylcholinester... Eur J Med Chem. 2009 Jun;44(6):2523-32. | |||||
REF 42 | Synthesis, biological evaluation, and molecular modeling of berberine derivatives as potent acetylcholinesterase inhibitors. Bioorg Med Chem. 2010 Feb;18(3):1244-51. | |||||
REF 43 | Novel heterobivalent tacrine derivatives as cholinesterase inhibitors with notable selectivity toward butyrylcholinesterase. J Med Chem. 2006 Dec 14;49(25):7540-4. | |||||
REF 44 | Design, synthesis and evaluation of 2,4-disubstituted pyrimidines as cholinesterase inhibitors. Bioorg Med Chem Lett. 2010 Jun 15;20(12):3606-9. | |||||
REF 45 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41. | |||||
REF 46 | Structure-activity relationships of acetylcholinesterase noncovalent inhibitors based on a polyamine backbone. 4. Further investigation on the inne... J Med Chem. 2008 Nov 27;51(22):7308-12. | |||||
REF 47 | Novel anticholinesterases based on the molecular skeletons of furobenzofuran and methanobenzodioxepine. J Med Chem. 2005 Feb 24;48(4):986-94. | |||||
REF 48 | Discovery of huperzine A-tacrine hybrids as potent inhibitors of human cholinesterases targeting their midgorge recognition sites. J Med Chem. 2006 Jun 1;49(11):3421-5. | |||||
REF 49 | Synthesis and pharmacological evaluation of huprine-tacrine heterodimers: subnanomolar dual binding site acetylcholinesterase inhibitors. J Med Chem. 2005 Mar 24;48(6):1701-4. | |||||
REF 50 | Isosorbide-2-carbamate esters: potent and selective butyrylcholinesterase inhibitors. J Med Chem. 2008 Oct 23;51(20):6400-9. | |||||
REF 51 | Isosorbide-2-benzyl carbamate-5-salicylate, a peripheral anionic site binding subnanomolar selective butyrylcholinesterase inhibitor. J Med Chem. 2010 Feb 11;53(3):1190-9. | |||||
REF 52 | Isosorbide-based cholinesterase inhibitors; replacement of 5-ester groups leading to increased stability. Bioorg Med Chem. 2010 Feb;18(3):1045-53. | |||||
REF 53 | Toward a rational design of multitarget-directed antioxidants: merging memoquin and lipoic acid molecular frameworks. J Med Chem. 2009 Dec 10;52(23):7883-6. | |||||
REF 54 | Synthesis and in vitro evaluation of N-alkyl-7-methoxytacrine hydrochlorides as potential cholinesterase inhibitors in Alzheimer disease. Bioorg Med Chem Lett. 2010 Oct 15;20(20):6093-5. | |||||
REF 55 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2471). | |||||
REF 56 | Nostocarboline: isolation and synthesis of a new cholinesterase inhibitor from Nostoc 78-12A. J Nat Prod. 2005 Dec;68(12):1793-5. | |||||
REF 57 | Steroidal alkaloids from the leaves of Sarcococca coriacea of Nepalese origin. J Nat Prod. 2001 Jun;64(6):842-4. | |||||
REF 58 | Acetylcholinesterase inhibitors: synthesis and structure-activity relationships of omega-[N-methyl-N-(3-alkylcarbamoyloxyphenyl)- methyl]aminoalkox... J Med Chem. 1998 Oct 8;41(21):3976-86. | |||||
REF 59 | Crystal structures of human cholinesterases in complex with huprine W and tacrine: elements of specificity for anti-Alzheimer's drugs targeting acetyl- and butyryl-cholinesterase. Biochem J. 2013 Aug 1;453(3):393-9. | |||||
REF 60 | N-Propargylpiperidines with naphthalene-2-carboxamide or naphthalene-2-sulfonamide moieties: Potential multifunctional anti-Alzheimer's agents. Bioorg Med Chem. 2017 Jan 15;25(2):633-645. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.