Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T53381
(Former ID: TTDS00030)
|
|||||
| Target Name |
Adrenergic receptor alpha-1D (ADRA1D)
|
|||||
| Synonyms |
Alpha-adrenergic receptor 1a; Alpha-1D adrenoreceptor; Alpha-1D adrenoceptor; Alpha-1D adrenergic receptor; Alpha adrenergic receptor 1a; Alpha 1D-adrenoreceptor; Alpha 1D-adrenoceptor; ADRA1A
Click to Show/Hide
|
|||||
| Gene Name |
ADRA1D
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 6 Target-related Diseases | + | ||||
| 1 | Glaucoma [ICD-11: 9C61] | |||||
| 2 | Heart failure [ICD-11: BD10-BD1Z] | |||||
| 3 | Hypertension [ICD-11: BA00-BA04] | |||||
| 4 | Prostate hyperplasia [ICD-11: GA90] | |||||
| 5 | Sexual dysfunction [ICD-11: HA00-HA01] | |||||
| 6 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| Function |
This alpha-adrenergic receptor mediates its effect through the influx of extracellular calcium.
Click to Show/Hide
|
|||||
| BioChemical Class |
GPCR rhodopsin
|
|||||
| UniProt ID | ||||||
| Sequence |
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE AVSLGVPHEVAEGATCQAYELADYSNLRETDI Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| HIT2.0 ID | T71QVU | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 7 Approved Drugs | + | ||||
| 1 | Alfuzosin | Drug Info | Approved | Benign prostatic hyperplasia | [2], [3] | |
| 2 | Armodafinil | Drug Info | Approved | Pediatric cancer | [4] | |
| 3 | Bunazosin | Drug Info | Approved | Glaucoma/ocular hypertension | [4] | |
| 4 | Doxazosin | Drug Info | Approved | Hypertension | [3], [5] | |
| 5 | Moxisylyte | Drug Info | Approved | Erectile dysfunction | [4] | |
| 6 | Terazosin | Drug Info | Approved | Benign prostatic hyperplasia | [6], [7] | |
| 7 | Trimazosin | Drug Info | Approved | Congestive heart failure | [4] | |
| Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
| 1 | MEDETOMIDINE | Drug Info | Phase 2 | Pain | [8] | |
| 2 | DL-017 | Drug Info | Phase 1 | Hypertension | [9] | |
| Patented Agent(s) | [+] 2 Patented Agents | + | ||||
| 1 | PMID30124346-Compound-LDT66 | Drug Info | Patented | Benign prostatic hyperplasia | [10] | |
| 2 | PMID30124346-Compound-LDT8 | Drug Info | Patented | Benign prostatic hyperplasia | [10] | |
| Discontinued Drug(s) | [+] 17 Discontinued Drugs | + | ||||
| 1 | INDORAMIN | Drug Info | Withdrawn from market | Hypertension | [4], [11] | |
| 2 | Dabuzalgron | Drug Info | Discontinued in Phase 2 | Urinary incontinence | [12], [13] | |
| 3 | Deriglidole | Drug Info | Discontinued in Phase 2 | Diabetic complication | [14] | |
| 4 | FCE-22716 | Drug Info | Discontinued in Phase 2 | Hypertension | [15] | |
| 5 | FIDUXOSIN HYDROCHLORIDE | Drug Info | Discontinued in Phase 2 | Prostate disease | [16] | |
| 6 | GYKI-16084 | Drug Info | Discontinued in Phase 2 | Prostate disease | [17] | |
| 7 | JTH-601 | Drug Info | Discontinued in Phase 2 | Prostate disease | [18] | |
| 8 | NS-49 | Drug Info | Discontinued in Phase 2 | Urinary incontinence | [19], [20] | |
| 9 | OPC-28326 | Drug Info | Discontinued in Phase 2 | Peripheral vascular disease | [21] | |
| 10 | REC-15-2739 | Drug Info | Discontinued in Phase 2 | Prostate disease | [22] | |
| 11 | SL-25.1039 | Drug Info | Discontinued in Phase 2 | Urinary incontinence | [23] | |
| 12 | SL-89.0591 | Drug Info | Discontinued in Phase 2 | Prostate disease | [24] | |
| 13 | SOU-001 | Drug Info | Discontinued in Phase 2 | Urinary incontinence | [25] | |
| 14 | SUN-9221 | Drug Info | Discontinued in Phase 1 | Hypertension | [26] | |
| 15 | CR-2991 | Drug Info | Terminated | Hypertension | [27] | |
| 16 | SL-91.0893 | Drug Info | Terminated | Prostate hyperplasia | [28] | |
| 17 | SNAP-5089 | Drug Info | Terminated | Heart arrhythmia | [29], [30] | |
| Mode of Action | [+] 4 Modes of Action | + | ||||
| Antagonist | [+] 9 Antagonist drugs | + | ||||
| 1 | Alfuzosin | Drug Info | [1] | |||
| 2 | Doxazosin | Drug Info | [34] | |||
| 3 | Terazosin | Drug Info | [36], [37] | |||
| 4 | PMID30124346-Compound-LDT8 | Drug Info | [10] | |||
| 5 | FIDUXOSIN HYDROCHLORIDE | Drug Info | [44] | |||
| 6 | GYKI-16084 | Drug Info | [45] | |||
| 7 | JTH-601 | Drug Info | [46] | |||
| 8 | OPC-28326 | Drug Info | [49] | |||
| 9 | CR-2991 | Drug Info | [57] | |||
| Agonist | [+] 4 Agonist drugs | + | ||||
| 1 | Armodafinil | Drug Info | [31], [32] | |||
| 2 | Dabuzalgron | Drug Info | [12] | |||
| 3 | SL-25.1039 | Drug Info | [51] | |||
| 4 | Beta-methoxyamphetamine | Drug Info | [74] | |||
| Modulator | [+] 12 Modulator drugs | + | ||||
| 1 | Bunazosin | Drug Info | [4], [33] | |||
| 2 | Moxisylyte | Drug Info | [4], [35] | |||
| 3 | Trimazosin | Drug Info | [4], [38] | |||
| 4 | DL-017 | Drug Info | [9] | |||
| 5 | Deriglidole | Drug Info | [43] | |||
| 6 | FCE-22716 | Drug Info | [15] | |||
| 7 | NS-49 | Drug Info | [48] | |||
| 8 | REC-15-2739 | Drug Info | [50] | |||
| 9 | SL-89.0591 | Drug Info | [52] | |||
| 10 | SOU-001 | Drug Info | [53] | |||
| 11 | SUN-9221 | Drug Info | [54] | |||
| 12 | SL-91.0893 | Drug Info | [60] | |||
| Inhibitor | [+] 61 Inhibitor drugs | + | ||||
| 1 | MEDETOMIDINE | Drug Info | [39] | |||
| 2 | INDORAMIN | Drug Info | [40] | |||
| 3 | Sunepitron | Drug Info | [41] | |||
| 4 | TIOSPIRONE | Drug Info | [42] | |||
| 5 | MAZAPERTINE | Drug Info | [47] | |||
| 6 | ABANOQUIL | Drug Info | [40] | |||
| 7 | AGN-193080 | Drug Info | [55] | |||
| 8 | BMY-7378 | Drug Info | [56] | |||
| 9 | NIGULDIPINE | Drug Info | [58] | |||
| 10 | Siramesine | Drug Info | [59] | |||
| 11 | SK&F-104078 | Drug Info | [58] | |||
| 12 | SK&F-104856 | Drug Info | [58] | |||
| 13 | SNAP-5089 | Drug Info | [58] | |||
| 14 | WB-4101 | Drug Info | [40] | |||
| 15 | (+/-)-nantenine | Drug Info | [61] | |||
| 16 | (2,6-Dichloro-phenyl)-(1H-imidazol-2-yl)-amine | Drug Info | [62] | |||
| 17 | (2-Bromo-phenyl)-(1H-imidazol-2-yl)-amine | Drug Info | [62] | |||
| 18 | 1',2',3',6'-Tetrahydro-[2,4']bipyridinyl | Drug Info | [63] | |||
| 19 | 1-(2-Chloro-phenyl)-piperazine | Drug Info | [64] | |||
| 20 | 1-(2-Methoxy-phenyl)-piperazine | Drug Info | [64] | |||
| 21 | 1-(3-Fluoro-pyridin-2-yl)-4-methyl-piperazine | Drug Info | [63] | |||
| 22 | 1-(pyridin-2-yl)piperazine | Drug Info | [63] | |||
| 23 | 2-Pyridin-4-yl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [65] | |||
| 24 | 4-((E)-1-Naphthalen-1-yl-propenyl)-1H-imidazole | Drug Info | [66] | |||
| 25 | 4-((Z)-1-Naphthalen-1-yl-propenyl)-1H-imidazole | Drug Info | [66] | |||
| 26 | 4-(1-Naphthalen-1-yl-ethyl)-1H-imidazole | Drug Info | [39] | |||
| 27 | 4-(1-Naphthalen-1-yl-propyl)-1H-imidazole | Drug Info | [66] | |||
| 28 | 4-(1-Naphthalen-1-yl-vinyl)-1H-imidazole | Drug Info | [66] | |||
| 29 | 4-(2,3-Dihydro-1H-phenalen-1-yl)-1H-imidazole | Drug Info | [66] | |||
| 30 | 4-(3,4-Dihydro-1H-isoquinolin-2-yl)-quinoline | Drug Info | [65] | |||
| 31 | 4-(3-Hydroxy-piperidin-3-yl)-benzene-1,2-diol | Drug Info | [67] | |||
| 32 | 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [68] | |||
| 33 | 4-(4-chlorobenzyl)-2-allylphthalazin-1(2H)-one | Drug Info | [69] | |||
| 34 | 4-(4-chlorobenzyl)-2-methylphthalazin-1(2H)-one | Drug Info | [69] | |||
| 35 | 4-(4-chlorobenzyl)phthalazin-1(2H)-one | Drug Info | [69] | |||
| 36 | 4-(4-Isopropyl-morpholin-2-yl)-benzene-1,2-diol | Drug Info | [67] | |||
| 37 | 4-(4-Methyl-indan-1-yl)-1H-imidazole | Drug Info | [70] | |||
| 38 | 4-Benzo[b]thiophen-4-yl-1H-imidazole | Drug Info | [71] | |||
| 39 | 4-benzyl-2-methylphthalazin-1(2H)-one | Drug Info | [69] | |||
| 40 | 4-Morpholin-2-yl-benzene-1,2-diol | Drug Info | [67] | |||
| 41 | 5-Bromo-8-piperazin-1-yl-imidazo[1,2-a]pyrazine | Drug Info | [72] | |||
| 42 | 6-hydroxy-3-(3',5'-dihydroxyphenyl)coumarin | Drug Info | [73] | |||
| 43 | 8-Piperazin-1-yl-imidazo[1,2-a]pyrazine | Drug Info | [72] | |||
| 44 | AGN-192172 | Drug Info | [55] | |||
| 45 | CORYNANTHEINE | Drug Info | [58] | |||
| 46 | FLUANISONE | Drug Info | [75] | |||
| 47 | Imidazolidin-2-ylidene-o-tolyl-amine | Drug Info | [55] | |||
| 48 | Imidazolidin-2-ylidene-quinoxalin-6-yl-amine | Drug Info | [55] | |||
| 49 | ISOCLOZAPINE | Drug Info | [76] | |||
| 50 | LEVONORDEFRIN | Drug Info | [66] | |||
| 51 | N-(5-Bromo-quinoxalin-6-yl)-guanidine | Drug Info | [55] | |||
| 52 | OCTOCLOTHEPIN | Drug Info | [77] | |||
| 53 | RWJ-38063 | Drug Info | [78] | |||
| 54 | RWJ-68157 | Drug Info | [78] | |||
| 55 | RWJ-69736 | Drug Info | [78] | |||
| 56 | SK&F-105854 | Drug Info | [58] | |||
| 57 | SK&F-106686 | Drug Info | [58] | |||
| 58 | SK&F-86466 | Drug Info | [58] | |||
| 59 | SNAP-8719 | Drug Info | [56] | |||
| 60 | UH-301 | Drug Info | [79] | |||
| 61 | [3H]RX821002 | Drug Info | [80] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Pathway Affiliation
Biological Network Descriptors
|
|
| KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
|---|---|---|---|
| Calcium signaling pathway | hsa04020 | Affiliated Target |
|
| Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
| cGMP-PKG signaling pathway | hsa04022 | Affiliated Target |
|
| Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
| Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
|
| Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy | ||
| Adrenergic signaling in cardiomyocytes | hsa04261 | Affiliated Target |
|
| Class: Organismal Systems => Circulatory system | Pathway Hierarchy | ||
| Vascular smooth muscle contraction | hsa04270 | Affiliated Target |
|
| Class: Organismal Systems => Circulatory system | Pathway Hierarchy | ||
| Salivary secretion | hsa04970 | Affiliated Target |
|
| Class: Organismal Systems => Digestive system | Pathway Hierarchy | ||
| Click to Show/Hide the Information of Affiliated Human Pathways | |||
| Degree | 1 | Degree centrality | 1.07E-04 | Betweenness centrality | 0.00E+00 |
|---|---|---|---|---|---|
| Closeness centrality | 1.86E-01 | Radiality | 1.31E+01 | Clustering coefficient | 0.00E+00 |
| Neighborhood connectivity | 5.20E+01 | Topological coefficient | 1.00E+00 | Eccentricity | 12 |
| Download | Click to Download the Full PPI Network of This Target | ||||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 6 KEGG Pathways | + | ||||
| 1 | Calcium signaling pathway | |||||
| 2 | cGMP-PKG signaling pathway | |||||
| 3 | Neuroactive ligand-receptor interaction | |||||
| 4 | Adrenergic signaling in cardiomyocytes | |||||
| 5 | Vascular smooth muscle contraction | |||||
| 6 | Salivary secretion | |||||
| NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
| 1 | IL2 Signaling Pathway | |||||
| Reactome | [+] 3 Reactome Pathways | + | ||||
| 1 | Adrenoceptors | |||||
| 2 | G alpha (q) signalling events | |||||
| 3 | G alpha (12/13) signalling events | |||||
| WikiPathways | [+] 7 WikiPathways | + | ||||
| 1 | Monoamine GPCRs | |||||
| 2 | Calcium Regulation in the Cardiac Cell | |||||
| 3 | GPCRs, Class A Rhodopsin-like | |||||
| 4 | Gastrin-CREB signalling pathway via PKC and MAPK | |||||
| 5 | GPCR ligand binding | |||||
| 6 | GPCR downstream signaling | |||||
| 7 | GPCRs, Other | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Alfuzosin: a review of the therapeutic use of the prolonged-release formulation given once daily in the management of benign prostatic hyperplasia. Drugs. 2002;62(4):633-53. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7109). | |||||
| REF 3 | Alpha blockers for the treatment of benign prostatic hyperplasia. Rev Urol. 2007 Fall;9(4):181-90. | |||||
| REF 4 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7170). | |||||
| REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7302). | |||||
| REF 7 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074823. | |||||
| REF 8 | Sedative and cardiopulmonary effects of medetomidine hydrochloride and xylazine hydrochloride and their reversal with atipamezole hydrochloride in calves. Am J Vet Res. 2008 Mar;69(3):319-29. | |||||
| REF 9 | Antihypertensive action and blockade of alpha1-adrenoceptors by DL-017, a quinazoline derivative. J Cardiovasc Pharmacol. 2001 Dec;38(6):893-9. | |||||
| REF 10 | 5-HT1A receptor ligands and their therapeutic applications: review of new patents.Expert Opin Ther Pat. 2018 Sep;28(9):679-689. | |||||
| REF 11 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 501). | |||||
| REF 12 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3469). | |||||
| REF 13 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013967) | |||||
| REF 14 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000010) | |||||
| REF 15 | Mechanism of the antihypertensive effect of FCE 22716, a new ergoline derivative, in the spontaneously hypertensive rat. Pharmacology. 1989;38(2):78-92. | |||||
| REF 16 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012814) | |||||
| REF 17 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010746) | |||||
| REF 18 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010685) | |||||
| REF 19 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 481). | |||||
| REF 20 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005693) | |||||
| REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011559) | |||||
| REF 22 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003537) | |||||
| REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014859) | |||||
| REF 24 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003628) | |||||
| REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014478) | |||||
| REF 26 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006767) | |||||
| REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018844) | |||||
| REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007056) | |||||
| REF 29 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 498). | |||||
| REF 30 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006771) | |||||
| REF 31 | Mechanisms of modafinil: A review of current research. Neuropsychiatr Dis Treat. 2007 June; 3(3): 349-364. | |||||
| REF 32 | US patent application no. 2014,0349,964, Methods for inducing orexin neurons and agent for treating narcolepsy or eating disorder. | |||||
| REF 33 | Bunazosin, a selective alpha1-adrenoceptor antagonist, as an anti-glaucoma drug: effects on ocular circulation and retinal neuronal damage. Cardiovasc Drug Rev. 2005 Spring;23(1):43-56. | |||||
| REF 34 | The role of combination medical therapy in benign prostatic hyperplasia. Int J Impot Res. 2008 Dec;20 Suppl 3:S33-43. | |||||
| REF 35 | Pharmacokinetics of moxisylyte in healthy volunteers after intracavernous injection of increasing doses. Eur J Clin Pharmacol. 1996;49(5):411-5. | |||||
| REF 36 | Induction of prostate apoptosis by alpha1-adrenoceptor antagonists: mechanistic significance of the quinazoline component. Prostate Cancer Prostatic Dis. 2002;5(2):88-95. | |||||
| REF 37 | Overexpression of the alpha1B-adrenergic receptor causes apoptotic neurodegeneration: multiple system atrophy. Nat Med. 2000 Dec;6(12):1388-94. | |||||
| REF 38 | The hypotensive effect of trimazosin is not caused solely by alpha 1-adrenoceptor blockade. J Cardiovasc Pharmacol. 1984 Jan-Feb;6(1):142-50. | |||||
| REF 39 | A structure-activity relationship study of benzylic modifications of 4-[1-(1-naphthyl)ethyl]-1H-imidazoles on alpha 1- and alpha 2-adrenergic recep... J Med Chem. 1994 Jul 22;37(15):2328-33. | |||||
| REF 40 | Alpha- and beta-adrenoceptors: from the gene to the clinic. 1. Molecular biology and adrenoceptor subclassification. J Med Chem. 1995 Sep 1;38(18):3415-44. | |||||
| REF 41 | An integrated in silico 3D model-driven discovery of a novel, potent, and selective amidosulfonamide 5-HT1A agonist (PRX-00023) for the treatment o... J Med Chem. 2006 Jun 1;49(11):3116-35. | |||||
| REF 42 | 3-Benzisothiazolylpiperazine derivatives as potential atypical antipsychotic agents. J Med Chem. 1996 Jan 5;39(1):143-8. | |||||
| REF 43 | Mechanisms of the hypoglycemic effects of the alpha2-adrenoceptor antagonists SL84.0418 and deriglidole. Life Sci. 1998;62(9):839-52. | |||||
| REF 44 | Effect of fiduxosin, an antagonist selective for alpha(1A)- and alpha(1D)-adrenoceptors, on intraurethral and arterial pressure responses in conscious dogs. J Pharmacol Exp Ther. 2002 Feb;300(2):487-94. | |||||
| REF 45 | A novel approach to the treatment of benign prostatic hyperplasia. BJU Int. 2006 Jun;97(6):1252-5. | |||||
| REF 46 | Effect of JTH-601, a novel alpha(1)-adrenoceptor antagonist, on prostate function in dogs. Eur J Pharmacol. 2000 Apr 7;394(1):123-30. | |||||
| REF 47 | A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem. 1994 Apr 15;37(8):1060-2. | |||||
| REF 48 | Pharmacokinetics of NS-49, a phenethylamine class alpha 1A-adrenoceptor agonist. 3rd communication: metabolism in rats, rabbits, dogs and monkeys, and effects on hepatic drug-metabolizing enzyme activities in rats after repeated administration. Arzneimittelforschung. 1999 Jul;49(7):612-7. | |||||
| REF 49 | Mechanisms of action of OPC-28326, a selective hindlimb vasodilator. J Pharmacol Exp Ther. 1999 Nov;291(2):604-11. | |||||
| REF 50 | Functional antagonistic activity of Rec 15/2739, a novel alpha-1 antagonist selective for the lower urinary tract, on noradrenaline-induced contraction of human prostate and mesenteric artery. J Pharmacol Exp Ther. 1996 Jun;277(3):1237-46. | |||||
| REF 51 | Pharmaceutical co analysis sanofi aventis, 2006, Page(216). | |||||
| REF 52 | Effects of alpha1-adrenoceptor antagonists on agonist and tilt-induced changes in blood pressure: relationships to uroselectivity. Eur J Pharmacol. 1999 May 28;373(1):51-62. | |||||
| REF 53 | Drug repositioning: identifying and developing new uses for existing drugs. Nat Rev Drug Discov. 2004 Aug;3(8):673-83. | |||||
| REF 54 | Synthesis and pharmacological evaluation of pyrroloazepine derivatives as potent antihypertensive agents with antiplatelet aggregation activity. Chem Pharm Bull (Tokyo). 1999 Feb;47(2):246-56. | |||||
| REF 55 | Analogs of UK 14,304: Structural features responsible for alpha2 adrenoceptor activity, Bioorg. Med. Chem. Lett. 5(15):1745-1750 (1995). | |||||
| REF 56 | Synthesis and structure-activity relationship of fluoro analogues of 8-{2-[4-(4-methoxyphenyl)piperazin-1yl]ethyl}-8-azaspiro[4.5]decane-7,9-dione ... J Med Chem. 2005 Apr 21;48(8):3076-9. | |||||
| REF 57 | WO patent application no. 2006,1244,90, Heterocycles as nicotinic acid receptor agonists for the treatment of dyslipidemia. | |||||
| REF 58 | Alpha- and beta-adrenoceptors: from the gene to the clinic. 2. Structure-activity relationships and therapeutic applications. J Med Chem. 1995 Sep 15;38(19):3681-716. | |||||
| REF 59 | Sigma ligands with subnanomolar affinity and preference for the sigma 2 binding site. 1. 3-(omega-aminoalkyl)-1H-indoles. J Med Chem. 1995 May 26;38(11):1998-2008. | |||||
| REF 60 | Tissue Selectivity of in vivo alpha1-Adrenoceptor Biding of KMD-3213 in Rats. Eur Urol 1999;36(suppl 1):113-117. | |||||
| REF 61 | Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. | |||||
| REF 62 | Synthesis and evaluation of 2-(arylamino)imidazoles as alpha 2-adrenergic agonists. J Med Chem. 1997 Jan 3;40(1):18-23. | |||||
| REF 63 | Adrenoceptor and tetrabenazine antagonism activities of some pyridinyltetrahydropyridines. J Med Chem. 1984 Sep;27(9):1182-5. | |||||
| REF 64 | Pyrimido[5,4-b]indole derivatives. 1. A new class of potent and selective alpha 1 adrenoceptor ligands. J Med Chem. 1991 Jun;34(6):1850-4. | |||||
| REF 65 | 4-(3,4-dihydro-1H-isoquinolin-2yl)-pyridines and 4-(3,4-dihydro-1H-isoquinolin-2-yl)-quinolines as potent NR1/2B subtype selective NMDA receptor an... Bioorg Med Chem Lett. 2003 May 19;13(10):1759-62. | |||||
| REF 66 | Medetomidine analogs as alpha 2-adrenergic ligands. 2. Design, synthesis, and biological activity of conformationally restricted naphthalene deriva... J Med Chem. 1996 Jul 19;39(15):3001-13. | |||||
| REF 67 | Conformational effects on the activity of drugs. 13. A revision of previously proposed models for the activation of alpha- and beta-adrenergic rece... J Med Chem. 1992 Mar 20;35(6):1009-18. | |||||
| REF 68 | Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97. | |||||
| REF 69 | Vasorelaxant activity of phthalazinones and related compounds. Bioorg Med Chem Lett. 2006 May 15;16(10):2786-90. | |||||
| REF 70 | Medetomidine analogs as alpha 2-adrenergic ligands. 3. Synthesis and biological evaluation of a new series of medetomidine analogs and their potent... J Med Chem. 1997 Sep 12;40(19):3014-24. | |||||
| REF 71 | alpha(2) Adrenoceptor agonists as potential analgesic agents. 2. Discovery of 4-(4-Imidazo)-1,3-dimethyl-6,7-dihydrothianaphthene [corrected] as a ... J Med Chem. 2000 Mar 9;43(5):765-8. | |||||
| REF 72 | Synthesis and hypoglycemic activity of substituted 8-(1-piperazinyl)imidazo[1,2-a]pyrazines. J Med Chem. 1992 Oct 16;35(21):3845-57. | |||||
| REF 73 | Design, synthesis, and vasorelaxant and platelet antiaggregatory activities of coumarin-resveratrol hybrids. Bioorg Med Chem Lett. 2006 Jan 15;16(2):257-61. | |||||
| REF 74 | Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77. | |||||
| REF 75 | 2-Phenylpyrroles as conformationally restricted benzamide analogues. A new class of potential antipsychotics. 1. J Med Chem. 1987 Nov;30(11):2099-104. | |||||
| REF 76 | Synthesis and pharmacological evaluation of triflate-substituted analogues of clozapine: identification of a novel atypical neuroleptic. J Med Chem. 1997 Dec 5;40(25):4146-53. | |||||
| REF 77 | Exploring the neuroleptic substituent in octoclothepin: potential ligands for positron emission tomography with subnanomolar affinity for (1)-adre... J Med Chem. 2010 Oct 14;53(19):7021-34. | |||||
| REF 78 | Novel arylpiperazines as selective alpha1-adrenergic receptor antagonists. Bioorg Med Chem Lett. 2000 May 15;10(10):1093-6. | |||||
| REF 79 | N-[2-[(substituted chroman-8-yl)oxy]ethyl]-4-(4-methoxyphenyl)butylamines: synthesis and wide range of antagonism at the human 5-HT1A receptor. J Med Chem. 1997 Apr 11;40(8):1252-7. | |||||
| REF 80 | Alpha-adrenoreceptor reagents. 4. Resolution of some potent selective prejunctional alpha 2-adrenoreceptor antagonists. J Med Chem. 1986 Oct;29(10):2000-3. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.