Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T67162
(Former ID: TTDS00012)
|
|||||
Target Name |
Dopamine D2 receptor (D2R)
|
|||||
Synonyms |
Dopamine receptor 2; D(2) dopamine receptor
Click to Show/Hide
|
|||||
Gene Name |
DRD2
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 33 Target-related Diseases | + | ||||
1 | Allergic/hypersensitivity disorder [ICD-11: 4A80-4A8Z] | |||||
2 | Alzheimer disease [ICD-11: 8A20] | |||||
3 | Asthma [ICD-11: CA23] | |||||
4 | Attention deficit hyperactivity disorder [ICD-11: 6A05] | |||||
5 | Bipolar disorder [ICD-11: 6A60] | |||||
6 | Breathing abnormality [ICD-11: MD11] | |||||
7 | Cardiovascular disease [ICD-11: BA00-BE2Z] | |||||
8 | Cerebral ischaemia [ICD-11: 8B1Z] | |||||
9 | Depression [ICD-11: 6A70-6A7Z] | |||||
10 | Digestive system disease [ICD-11: DE2Z] | |||||
11 | Essential hypertension [ICD-11: BA00] | |||||
12 | Faecal incontinence [ICD-11: ME07] | |||||
13 | Gangrene [ICD-11: MC85] | |||||
14 | Glaucoma [ICD-11: 9C61] | |||||
15 | Heart failure [ICD-11: BD10-BD1Z] | |||||
16 | Hyperaemia [ICD-11: 9A61-9B7Y] | |||||
17 | Hypertension [ICD-11: BA00-BA04] | |||||
18 | Hypotension [ICD-11: BA20-BA21] | |||||
19 | Inborn porphyrin/heme metabolism error [ICD-11: 5C58] | |||||
20 | Insomnia [ICD-11: 7A00-7A0Z] | |||||
21 | Itching [ICD-11: 1F28-1G07] | |||||
22 | Migraine [ICD-11: 8A80] | |||||
23 | Nausea/vomiting [ICD-11: MD90] | |||||
24 | Pain [ICD-11: MG30-MG3Z] | |||||
25 | Parkinsonism [ICD-11: 8A00] | |||||
26 | Pituitary gland disorder [ICD-11: 5A60-5A61] | |||||
27 | Postpartum haemorrhage [ICD-11: JA43] | |||||
28 | Psychotic disorder [ICD-11: 6A20-6A25] | |||||
29 | Pulmonary hypertension [ICD-11: BB01] | |||||
30 | Schizophrenia [ICD-11: 6A20] | |||||
31 | Substance abuse [ICD-11: 6C40] | |||||
32 | Thyrotoxicosis [ICD-11: 5A02] | |||||
33 | Type 2 diabetes mellitus [ICD-11: 5A11] | |||||
Function |
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA VNPIIYTTFNIEFRKAFLKILHC Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
ADReCS ID | BADD_A03272 ; BADD_A04234 | |||||
HIT2.0 ID | T48ZIG |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 70 Approved Drugs | + | ||||
1 | Acetophenazine | Drug Info | Approved | Bipolar disorder | [2], [3] | |
2 | Amisulpride | Drug Info | Approved | Schizophrenia | [4], [5] | |
3 | Aniracetam | Drug Info | Approved | Cerebrovascular ischaemia | [6], [7] | |
4 | Apomorphine | Drug Info | Approved | Parkinson disease | [8], [9] | |
5 | Aripiprazole | Drug Info | Approved | Schizophrenia | [10], [11] | |
6 | Bevantolol | Drug Info | Approved | Hypertension | [3], [5] | |
7 | Bromocriptine | Drug Info | Approved | Parkinson disease | [12], [13] | |
8 | Cabergoline | Drug Info | Approved | Hyperprolactinaemia | [13], [14] | |
9 | Cariprazine | Drug Info | Approved | Bipolar disorder | [15], [16] | |
10 | Carphenazine | Drug Info | Approved | Insomnia | [3] | |
11 | Chlorpromazine | Drug Info | Approved | Schizophrenia | [17], [18] | |
12 | Chlorprothixene | Drug Info | Approved | Psychotic disorder | [19] | |
13 | Dapiprazole | Drug Info | Approved | Glaucoma/ocular hypertension | [3] | |
14 | Denopamine | Drug Info | Approved | Cardiac disease | [3], [20] | |
15 | Dihydroergotamine | Drug Info | Approved | Migraine | [21] | |
16 | Dihydroergotoxine | Drug Info | Approved | Alzheimer disease | [22] | |
17 | Docarpamine | Drug Info | Approved | Hypertension | [3] | |
18 | Domperidone | Drug Info | Approved | Gastrointestinal disease | [23], [24] | |
19 | Dopamine | Drug Info | Approved | Parkinson disease | [25], [26] | |
20 | Dopexamine | Drug Info | Approved | Cardiac failure | [3] | |
21 | Droperidol | Drug Info | Approved | Nausea | [27], [28] | |
22 | Ephedrine | Drug Info | Approved | Asthma | [29], [30] | |
23 | Ergonovine | Drug Info | Approved | Postpartum haemorrhage | [31], [32] | |
24 | Fluspirilene | Drug Info | Approved | Schizophrenia | [33], [34] | |
25 | Haloperidol | Drug Info | Approved | Schizophrenia | [5], [35] | |
26 | Ibopamine hci | Drug Info | Approved | Cardiac disease | [3] | |
27 | Iloperidone | Drug Info | Approved | Schizophrenia | [36], [37] | |
28 | Levodopa | Drug Info | Approved | Parkinson disease | [38] | |
29 | Levomepromazine | Drug Info | Approved | Psychotic disorder | [3] | |
30 | Lisuride | Drug Info | Approved | Parkinson disease | [39], [40] | |
31 | Loxapine | Drug Info | Approved | Schizophrenia | [3] | |
32 | lumateperone tosylate | Drug Info | Approved | Schizophrenia | [41] | |
33 | Lurasidone hydrochloride | Drug Info | Approved | Schizophrenia | [3], [42], [43], [44] | |
34 | Meglitinides | Drug Info | Approved | Type-2 diabetes | [45] | |
35 | Mephentermine | Drug Info | Approved | High blood pressure | [3] | |
36 | Mesoridazine | Drug Info | Approved | Schizophrenia | [46], [47] | |
37 | Metaraminol | Drug Info | Approved | Hypotension | [48], [49] | |
38 | Methamphetamine | Drug Info | Approved | Pain | [50] | |
39 | Methyldopa | Drug Info | Approved | Hypertension | [51], [52] | |
40 | Metoclopramide | Drug Info | Approved | Nausea | [53], [54] | |
41 | Molindone | Drug Info | Approved | Schizophrenia | [55], [56] | |
42 | N-0923 | Drug Info | Approved | Parkinson disease | [57], [58] | |
43 | Naphazoline | Drug Info | Approved | Itching | [3] | |
44 | Nemonapride | Drug Info | Approved | Schizophrenia | [59], [26] | |
45 | Olanzapine | Drug Info | Approved | Schizophrenia | [60], [61] | |
46 | OPC-34712 | Drug Info | Approved | Major depressive disorder | [62], [63] | |
47 | Perazine | Drug Info | Approved | Psychotic disorder | [3] | |
48 | Pergolide | Drug Info | Approved | Parkinson disease | [64], [13] | |
49 | Perphenazine | Drug Info | Approved | Schizophrenia | [65], [66] | |
50 | Phenoxybenzamine | Drug Info | Approved | Malignant essential hypertension | [3] | |
51 | Phentolamine | Drug Info | Approved | Dermal necrosis | [67], [68] | |
52 | Phenylephrine | Drug Info | Approved | Fecal incontinence | [69] | |
53 | Phenyltoloxamine | Drug Info | Approved | Allergy | [3] | |
54 | Pimozide | Drug Info | Approved | Schizophrenia | [70], [71] | |
55 | Piperacetazine | Drug Info | Approved | Schizophrenia | [3] | |
56 | Pramipexole | Drug Info | Approved | Parkinson disease | [72], [73] | |
57 | Prochlorperazine | Drug Info | Approved | Nausea | [74], [75] | |
58 | Pseudoephedrine | Drug Info | Approved | Nasal congestion | [76], [77] | |
59 | Quetiapine | Drug Info | Approved | Schizophrenia | [26], [78], [79] | |
60 | Quinagolide | Drug Info | Approved | Hyperprolactinaemia | [5] | |
61 | Risperidone | Drug Info | Approved | Schizophrenia | [80], [81] | |
62 | Ropinirole | Drug Info | Approved | Parkinson disease | [82], [83] | |
63 | Sulpiride | Drug Info | Approved | Schizophrenia | [84], [85] | |
64 | Thiethylperazine | Drug Info | Approved | Nausea | [86], [87] | |
65 | Thioridazine | Drug Info | Approved | Schizophrenia | [88], [89] | |
66 | Thiothixene | Drug Info | Approved | Schizophrenia | [90], [91] | |
67 | Tiapride | Drug Info | Approved | Alcohol dependence | [3] | |
68 | Tolazoline | Drug Info | Approved | Pulmonary hypertension | [92], [93], [3] | |
69 | Ziprasidone | Drug Info | Approved | Schizophrenia | [26], [94], [81] | |
70 | Zuclopenthixol | Drug Info | Approved | Schizophrenia | [95], [96] | |
Clinical Trial Drug(s) | [+] 45 Clinical Trial Drugs | + | ||||
1 | Bis(olanzapine) pamoate monohydrate | Drug Info | Phase 3 | Psychotic disorder | [3] | |
2 | Blonanserin | Drug Info | Phase 3 | Schizophrenia | [97], [26] | |
3 | CQA 206-291 | Drug Info | Phase 3 | Parkinson disease | [98] | |
4 | Entacapone+levodopa+carbidopa | Drug Info | Phase 3 | Restless legs syndrome | [99] | |
5 | esamisulpride | Drug Info | Phase 3 | Bipolar disorder | [100] | |
6 | Lu AF35700 | Drug Info | Phase 3 | Schizophrenia | [101] | |
7 | P2B-001 | Drug Info | Phase 3 | Parkinson disease | [102] | |
8 | Pridopidine | Drug Info | Phase 3 | Huntington disease | [103] | |
9 | RBP-7000 | Drug Info | Phase 3 | Non-small-cell lung cancer | [104] | |
10 | Sumanirole | Drug Info | Phase 3 | Parkinson disease | [105], [106] | |
11 | Zicronapine | Drug Info | Phase 3 | Schizophrenia | [107] | |
12 | Sarizotan | Drug Info | Phase 2/3 | Rett syndrome | [102] | |
13 | APD-403 | Drug Info | Phase 2 | Vomiting | [108] | |
14 | Aplindore fumarate | Drug Info | Phase 2 | Schizophrenia | [26] | |
15 | BIM23A760 | Drug Info | Phase 2 | Acromegaly | [109], [110] | |
16 | BL-1020 | Drug Info | Phase 2 | Schizophrenia | [26] | |
17 | CGS-15873A | Drug Info | Phase 2 | Psychotic disorder | [111] | |
18 | CLR-3001 | Drug Info | Phase 2 | Major depressive disorder | [112] | |
19 | JNJ-37822681 | Drug Info | Phase 2 | Schizophrenia | [113] | |
20 | Mazapertine succinate | Drug Info | Phase 2 | Psychotic disorder | [114] | |
21 | Ocaperidone | Drug Info | Phase 2 | Schizoaffective disorder | [115], [26], [116] | |
22 | ONC201 | Drug Info | Phase 2 | Glioma | [117], [102] | |
23 | Pardoprunox | Drug Info | Phase 2 | Parkinson disease | [73] | |
24 | PD-143188 | Drug Info | Phase 2 | Psychotic disorder | [118] | |
25 | ROXINDOLE | Drug Info | Phase 2 | Psychotic disorder | [119], [120] | |
26 | RP5063 | Drug Info | Phase 2 | Schizophrenia | [121] | |
27 | SDZ-MAR-327 | Drug Info | Phase 2 | Psychotic disorder | [26], [122] | |
28 | SEP--4199 | Drug Info | Phase 2 | Bipolar disorder | [123] | |
29 | TAK-906 | Drug Info | Phase 2 | Diabetic gastroparesis | [124] | |
30 | TBR-760 | Drug Info | Phase 2 | Pituitary adenoma | [125] | |
31 | XP-21279 | Drug Info | Phase 2 | Parkinson disease | [126] | |
32 | (-)-3PPP, Maryland | Drug Info | Phase 1 | Schizophrenia | [127] | |
33 | 1192U90 | Drug Info | Phase 1 | Psychotic disorder | [128] | |
34 | Abaperidone | Drug Info | Phase 1 | Schizophrenia | [129] | |
35 | ATI-9242 | Drug Info | Phase 1 | Schizophrenia | [101] | |
36 | Carmoxirole | Drug Info | Phase 1 | Hypertension | [130] | |
37 | DSP-1200 | Drug Info | Phase 1 | Depression | [101] | |
38 | Lu AF28996 | Drug Info | Phase 1 | Parkinson disease | [131] | |
39 | Lu-02-750 | Drug Info | Phase 1 | Parkinson disease | [132] | |
40 | Lu-AE04621 | Drug Info | Phase 1 | Parkinson disease | [133] | |
41 | ONC206 | Drug Info | Phase 1 | Brain and central nervous system tumour | [134] | |
42 | SKL-10406 | Drug Info | Phase 1 | Major depressive disorder | [135] | |
43 | SSR-181507 | Drug Info | Phase 1 | Schizophrenia | [26] | |
44 | Umespirone | Drug Info | Phase 1 | Anxiety disorder | [136] | |
45 | YKP-1358 | Drug Info | Phase 1 | Schizoaffective disorder | [26] | |
Patented Agent(s) | [+] 3 Patented Agents | + | ||||
1 | PMID30124346-Compound-13TABLE4 | Drug Info | Patented | Attention deficit hyperactivity disorder | [137] | |
2 | PMID30124346-Compound-34TABLE4 | Drug Info | Patented | Attention deficit hyperactivity disorder | [137] | |
3 | PMID30124346-Compound-60TABLE5 | Drug Info | Patented | Parkinson disease | [138], [139], [137] | |
Discontinued Drug(s) | [+] 43 Discontinued Drugs | + | ||||
1 | Fencamfamine | Drug Info | Withdrawn from market | Depressive fatigue | [140] | |
2 | Flupenthixol | Drug Info | Withdrawn from market | Schizophrenia | [141], [142] | |
3 | Nomifensine | Drug Info | Withdrawn from market | Breast cancer | [143], [3] | |
4 | Remoxipride | Drug Info | Withdrawn from market | Schizophrenia | [144] | |
5 | Sertindole | Drug Info | Withdrawn from market | Schizophrenia | [145], [146] | |
6 | (S)-amisulpride | Drug Info | Discontinued in Phase 4 | Schizophrenia | [26] | |
7 | Bifeprunox | Drug Info | Discontinued in Phase 3 | Schizophrenia | [26] | |
8 | Lamectacin | Drug Info | Discontinued in Phase 3 | Bacterial infection | [147] | |
9 | NOLOMIROLE HYDROCHLORIDE | Drug Info | Discontinued in Phase 3 | Heart failure | [148] | |
10 | Sibenadet | Drug Info | Discontinued in Phase 3 | Chronic obstructive pulmonary disease | [149] | |
11 | BAM-1110 | Drug Info | Discontinued in Phase 2 | Parkinson disease | [150] | |
12 | Declopramide | Drug Info | Discontinued in Phase 2 | Inflammatory bowel disease | [151] | |
13 | FOSOPAMINE | Drug Info | Discontinued in Phase 2 | Hypertension | [152] | |
14 | Naxagolide | Drug Info | Discontinued in Phase 2 | Parkinson disease | [153] | |
15 | PF-217830 | Drug Info | Discontinued in Phase 2 | Schizophrenia | [154] | |
16 | Romergoline | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [155] | |
17 | SAVOXEPIN MESYLATE | Drug Info | Discontinued in Phase 2 | Psychotic disorder | [156] | |
18 | SLV-310 | Drug Info | Discontinued in Phase 2 | Schizophrenia | [26] | |
19 | AM-831 | Drug Info | Discontinued in Phase 1 | Schizophrenia | [157] | |
20 | DU-29894 | Drug Info | Discontinued in Phase 1 | Psychotic disorder | [158] | |
21 | Ordopidine | Drug Info | Discontinued in Phase 1 | Psychotic disorder | [159] | |
22 | S-18327 | Drug Info | Discontinued in Phase 1 | Psychotic disorder | [160] | |
23 | SDZ-GLC-756 | Drug Info | Discontinued in Phase 1 | Glaucoma/ocular hypertension | [161] | |
24 | SLV-313 | Drug Info | Discontinued in Phase 1 | Schizophrenia | [26] | |
25 | A-68930 | Drug Info | Terminated | Hypertension | [165], [166] | |
26 | AMR-103 | Drug Info | Terminated | Parkinson disease | [167] | |
27 | BIMG80 | Drug Info | Terminated | Psychotic disorder | [168] | |
28 | CGP-25454A | Drug Info | Terminated | Major depressive disorder | [169] | |
29 | CP-903397 | Drug Info | Terminated | Schizophrenia | [170] | |
30 | Dianicline+rimonabant | Drug Info | Terminated | Tobacco dependence | [171] | |
31 | E-2040 | Drug Info | Terminated | Schizophrenia | [172] | |
32 | Etrabamine | Drug Info | Terminated | Parkinson disease | [173] | |
33 | GMC-283 | Drug Info | Terminated | Schizophrenia | [26] | |
34 | LY-243062 | Drug Info | Terminated | Inflammation | [174] | |
35 | NGD-93-1 | Drug Info | Terminated | Psychotic disorder | [175] | |
36 | NNC-22-0031 | Drug Info | Terminated | Psychotic disorder | [176] | |
37 | Org-10490 | Drug Info | Terminated | Psychotic disorder | [177] | |
38 | PNU-96391A | Drug Info | Terminated | Substance use disorder | [178] | |
39 | RWJ-25730 | Drug Info | Terminated | Psychotic disorder | [179] | |
40 | SLV-307 | Drug Info | Terminated | Parkinson disease | [180] | |
41 | Y-20024 | Drug Info | Terminated | Psychotic disorder | [181] | |
42 | Y-931 | Drug Info | Terminated | Schizophrenia | [26] | |
43 | ZD-3638 | Drug Info | Terminated | Schizophrenia | [26] | |
Preclinical Drug(s) | [+] 6 Preclinical Drugs | + | ||||
1 | F-15063 | Drug Info | Preclinical | Schizophrenia | [162] | |
2 | Org-23366 | Drug Info | Preclinical | Schizophrenia | [26] | |
3 | PD-157695 | Drug Info | Preclinical | Schizophrenia | [26] | |
4 | PD-158771 | Drug Info | Preclinical | Schizophrenia | [26] | |
5 | PGX-200097 | Drug Info | Preclinical | Schizophrenia | [163] | |
6 | S32504 | Drug Info | Preclinical | Parkinson disease | [164] | |
Mode of Action | [+] 8 Modes of Action | + | ||||
Antagonist | [+] 60 Antagonist drugs | + | ||||
1 | Acetophenazine | Drug Info | [182], [183] | |||
2 | Amisulpride | Drug Info | [182], [184], [185] | |||
3 | Bevantolol | Drug Info | [189], [190] | |||
4 | Carphenazine | Drug Info | [182], [195] | |||
5 | Chlorpromazine | Drug Info | [196], [197], [198] | |||
6 | Chlorprothixene | Drug Info | [199] | |||
7 | Dapiprazole | Drug Info | [200] | |||
8 | Domperidone | Drug Info | [202], [203] | |||
9 | Fluspirilene | Drug Info | [208] | |||
10 | Haloperidol | Drug Info | [209], [182] | |||
11 | Iloperidone | Drug Info | [37], [26] | |||
12 | Loxapine | Drug Info | [215] | |||
13 | lumateperone tosylate | Drug Info | [41] | |||
14 | Meglitinides | Drug Info | [216], [217] | |||
15 | Metoclopramide | Drug Info | [222], [203] | |||
16 | Perphenazine | Drug Info | [229], [230] | |||
17 | Phenoxybenzamine | Drug Info | [231] | |||
18 | Phentolamine | Drug Info | [232] | |||
19 | Pimozide | Drug Info | [236], [182] | |||
20 | Prochlorperazine | Drug Info | [237], [238] | |||
21 | Risperidone | Drug Info | [243], [244] | |||
22 | Sulpiride | Drug Info | [217], [245], [246] | |||
23 | Thiethylperazine | Drug Info | [247], [248] | |||
24 | Thioridazine | Drug Info | [249], [250] | |||
25 | Thiothixene | Drug Info | [251] | |||
26 | Tiapride | Drug Info | [245] | |||
27 | Tolazoline | Drug Info | [252] | |||
28 | Zuclopenthixol | Drug Info | [254], [182] | |||
29 | Blonanserin | Drug Info | [26] | |||
30 | esamisulpride | Drug Info | [258] | |||
31 | APD-403 | Drug Info | [265] | |||
32 | BL-1020 | Drug Info | [26] | |||
33 | ONC201 | Drug Info | [117] | |||
34 | RP5063 | Drug Info | [272], [273] | |||
35 | SEP--4199 | Drug Info | [123] | |||
36 | 1192U90 | Drug Info | [26] | |||
37 | DSP-1200 | Drug Info | [101] | |||
38 | ONC206 | Drug Info | [284] | |||
39 | Umespirone | Drug Info | [287] | |||
40 | L-piperazino-3-phenyl-indane derivative 1 | Drug Info | [290] | |||
41 | Flupenthixol | Drug Info | [292], [182] | |||
42 | Nomifensine | Drug Info | [293], [294] | |||
43 | Remoxipride | Drug Info | [182], [215] | |||
44 | Sertindole | Drug Info | [295], [296] | |||
45 | (S)-amisulpride | Drug Info | [26] | |||
46 | Lamectacin | Drug Info | [298], [79] | |||
47 | Org-23366 | Drug Info | [26] | |||
48 | PD-157695 | Drug Info | [26] | |||
49 | PD-158771 | Drug Info | [26] | |||
50 | Dianicline+rimonabant | Drug Info | [324] | |||
51 | GMC-283 | Drug Info | [26] | |||
52 | SLV-307 | Drug Info | [331] | |||
53 | (+)-S-14297 | Drug Info | [335] | |||
54 | Anti-D | Drug Info | [372] | |||
55 | CLR-151 | Drug Info | [265] | |||
56 | ML321 | Drug Info | [392] | |||
57 | nafadotride | Drug Info | [397] | |||
58 | S-(-)-sulpiride | Drug Info | [217], [245], [246] | |||
59 | [3H]N-methylspiperone | Drug Info | [418], [419] | |||
60 | [3H]spiperone | Drug Info | [420], [334] | |||
Inhibitor | [+] 202 Inhibitor drugs | + | ||||
1 | Aniracetam | Drug Info | [186] | |||
2 | Phenyltoloxamine | Drug Info | [235] | |||
3 | P2B-001 | Drug Info | [259] | |||
4 | ROXINDOLE | Drug Info | [271] | |||
5 | TAK-906 | Drug Info | [275] | |||
6 | TIOSPIRONE | Drug Info | [301] | |||
7 | MAZAPERTINE | Drug Info | [305] | |||
8 | PGX-200097 | Drug Info | [317] | |||
9 | A-68930 | Drug Info | [318] | |||
10 | A-80426 | Drug Info | [319] | |||
11 | PD-128483 | Drug Info | [329] | |||
12 | (+)-(1R,1'S)-berbamunine hydrochloride | Drug Info | [333] | |||
13 | (+)-(1R,1'S)-thaligrisine hydrochloride | Drug Info | [333] | |||
14 | (+)-BUTACLAMOL | Drug Info | [334] | |||
15 | (+/-)-nantenine | Drug Info | [336] | |||
16 | (-)-(1S,1'R)-O,O-dimethylgrisbine hydrochloride | Drug Info | [333] | |||
17 | (-)-3-(1-Propyl-piperidin-3-yl)-benzonitrile | Drug Info | [337] | |||
18 | (4-Ethynyl-cyclohex-3-enyl)-dipropyl-amine | Drug Info | [338] | |||
19 | (4-Quinolin-2-ylpiperazin-1-yl)acetic Acid | Drug Info | [339] | |||
20 | (5-Methoxy-chroman-3-yl)-dipropyl-amine | Drug Info | [340] | |||
21 | (R)-(+)-coclaurine | Drug Info | [341] | |||
22 | (R)-(-)-10-methyl-11-hydroxyaporphine | Drug Info | [342] | |||
23 | (R)-(-)-11-hydroxy-N-n-propylnoraporphine | Drug Info | [343] | |||
24 | (R)-(-)-2-methoxy-11-hydroxyaporphine | Drug Info | [343] | |||
25 | (R)-(-)-2-methoxy-N-npropylnorapomorphine | Drug Info | [343] | |||
26 | (R)-(-)-2-Methyl-apomorphine hydrochloride | Drug Info | [344] | |||
27 | (R)-(-)-2-Phenyl-apomorphine hydrochloride | Drug Info | [344] | |||
28 | (R)-(-)-N-ethyl-2-methoxy-11-hydroxynoraporphine | Drug Info | [343] | |||
29 | (R)-(-)-N-propyl-2-methoxy-11-hydroxynoraporphine | Drug Info | [343] | |||
30 | (S)-BULBOCAPNINE | Drug Info | [345] | |||
31 | (S)-secoantioquine hydrochloride | Drug Info | [333] | |||
32 | (S)APOMORPHINE | Drug Info | [346] | |||
33 | (S,R)-antioquine hydrochloride | Drug Info | [333] | |||
34 | (S,R)-isotetrandrine hydrochloride | Drug Info | [333] | |||
35 | (S,R)-pseudoxandrine hydrochloride | Drug Info | [333] | |||
36 | (S,S)-oxandrine hydrochloride | Drug Info | [333] | |||
37 | 1,2,3,7,12,12a-hexahydro-1-aza-pleiadene-5,6-diol | Drug Info | [345] | |||
38 | 1,2-Bis-[R-(-)-apomorphine-2'-oxy]ethane | Drug Info | [347] | |||
39 | 1,6-bis(4-(3-chlorophenyl)piperazin-1-yl)hexane | Drug Info | [348] | |||
40 | 1,6-bis(4-(3-methoxyphenyl)piperazin-1-yl)hexane | Drug Info | [348] | |||
41 | 1,6-bis(4-(pyridin-2-yl)piperazin-1-yl)hexane | Drug Info | [348] | |||
42 | 1,6-bis(4-m-tolylpiperazin-1-yl)hexane | Drug Info | [348] | |||
43 | 1,6-bis(4-phenylpiperazin-1-yl)hexane | Drug Info | [348] | |||
44 | 1-(3-Hydroxyphenyl)-4-propylpiperazine | Drug Info | [261] | |||
45 | 1-(4-(1H-pyrazol-1-yl)benzyl)-4-phenylpiperazine | Drug Info | [349] | |||
46 | 1-(4-(4-phenyl-1-piperazinyl)butyl)indolin-2-one | Drug Info | [350] | |||
47 | 1-(benzyloxy)-2-(2-phenylethyl)benzene | Drug Info | [351] | |||
48 | 1-(benzyloxy)-2-[2-(3-methoxyphenyl)ethyl]benzene | Drug Info | [351] | |||
49 | 1-Aminomethyl-3-cyclohexyl-isochroman-5,6-diol | Drug Info | [352] | |||
50 | 1-Aminomethyl-isochroman-5,6-diol | Drug Info | [318] | |||
51 | 1-Benzyl-4-(2-ethynyl-pyrrol-1-yl)-piperidine | Drug Info | [353] | |||
52 | 1-Benzyl-4-(2-iodo-pyrrol-1-yl)-piperidine | Drug Info | [353] | |||
53 | 1-Benzyl-4-(2-oxazol-5-yl-pyrrol-1-yl)-piperidine | Drug Info | [353] | |||
54 | 1-Benzyl-4-(3-hydroxyphenyl)piperidine | Drug Info | [261] | |||
55 | 1-Benzyl-4-(3-oxazol-5-yl-pyrrol-1-yl)-piperidine | Drug Info | [353] | |||
56 | 1-Benzyl-4-pyrrol-1-yl-piperidine | Drug Info | [353] | |||
57 | 1-Benzyl-4-[3-(methylsulfonyl)phenyl]piperazine | Drug Info | [261] | |||
58 | 1-Benzyl-4-[3-(methylsulfonyl)phenyl]piperidine | Drug Info | [261] | |||
59 | 1-Dibenzo[b,f]oxepin-10-yl-4-methyl-piperazine | Drug Info | [354] | |||
60 | 1-Methyl-1,2,3,4-tetrahydro-isoquinoline-6,7-diol | Drug Info | [355] | |||
61 | 1-Propyl-3-(3-trifluoromethyl-phenyl)-pyrrolidine | Drug Info | [356] | |||
62 | 1-Propyl-3-m-tolyl-piperidine hydrochloride | Drug Info | [357] | |||
63 | 1-Propyl-3-o-tolyl-piperidine hydrochloride | Drug Info | [357] | |||
64 | 1-Propyl-3-p-tolyl-piperidine hydrochloride | Drug Info | [357] | |||
65 | 1-[(3-methoxybenzyl)oxy]-2-(2-phenylethyl)benzene | Drug Info | [351] | |||
66 | 1-[2-(2-Benzyl-phenoxy)-ethyl]-piperidine | Drug Info | [235] | |||
67 | 1-[3-(2-Benzyl-phenoxy)-propyl]-pyrrolidine | Drug Info | [235] | |||
68 | 1-[3-(Methylsulfonyl)phenyl]-4-propylpiperazine | Drug Info | [261] | |||
69 | 2,3-Dihydro-1H-indol-5-ol | Drug Info | [355] | |||
70 | 2-(4-Dipropylamino-cyclohexylidene)-malononitrile | Drug Info | [338] | |||
71 | 2-methoxyapomorphine | Drug Info | [347] | |||
72 | 2-Methyl-8-phenyl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [358] | |||
73 | 2-{[2-(2-phenylethyl)phenoxy]methyl}pyridine | Drug Info | [351] | |||
74 | 2-{[R-(-)-Apomorphine-2'-oxy]ethoxy}-ethanol | Drug Info | [347] | |||
75 | 3,8-dibromoboldine | Drug Info | [359] | |||
76 | 3-(1-Propyl-pyrrolidin-3-yl)-phenol | Drug Info | [356] | |||
77 | 3-(2,3-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [360] | |||
78 | 3-(2,3-Dimethyl-phenyl)-piperidine | Drug Info | [360] | |||
79 | 3-(2,4-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [360] | |||
80 | 3-(2,5-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [360] | |||
81 | 3-(2,6-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [360] | |||
82 | 3-(2-Benzylamino-ethoxy)-phenol | Drug Info | [361] | |||
83 | 3-(3,4-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [360] | |||
84 | 3-(3,4-Dimethyl-phenyl)-piperidine | Drug Info | [360] | |||
85 | 3-(3,5-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [360] | |||
86 | 3-(3,5-Dimethyl-phenyl)-piperidine | Drug Info | [360] | |||
87 | 3-(4-Benzyl-piperazin-1-yl)-phenol | Drug Info | [362] | |||
88 | 3-(4-Benzyl-piperidin-1-ylmethyl)-chroman-4-one | Drug Info | [334] | |||
89 | 3-(4-Methyl-piperidin-1-ylmethyl)-1H-indole | Drug Info | [363] | |||
90 | 3-(4-Phenyl-piperazin-1-ylmethyl)-1H-indole | Drug Info | [363] | |||
91 | 3-(4-Phenyl-piperidin-1-ylmethyl)-1H-indole | Drug Info | [363] | |||
92 | 3-(N-propylpiperidin-4-yl)phenol | Drug Info | [261] | |||
93 | 3-(Octahydro-indolizin-8-yl)-phenol | Drug Info | [364] | |||
94 | 3-(Octahydro-quinolizin-1-yl)-phenol | Drug Info | [364] | |||
95 | 3-(Octahydro-quinolizin-3-yl)-phenol | Drug Info | [364] | |||
96 | 3-bromoboldine | Drug Info | [359] | |||
97 | 3-Butyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol | Drug Info | [365] | |||
98 | 3-Chloroboldine | Drug Info | [359] | |||
99 | 3-Cyclohexyl-1-propyl-piperidine hydrochloride | Drug Info | [357] | |||
100 | 3-Ethyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol | Drug Info | [365] | |||
101 | 3-Iodoboldine | Drug Info | [359] | |||
102 | 3-Naphthalen-1-yl-1-propyl-pyrrolidine | Drug Info | [356] | |||
103 | 3-Naphthalen-1-yl-pyrrolidine | Drug Info | [356] | |||
104 | 3-Phenyl-1-propyl-piperidine hydrochloride | Drug Info | [357] | |||
105 | 3-Phenyl-1-propyl-pyrrolidine | Drug Info | [356] | |||
106 | 3-Phenyl-pyrrolidine | Drug Info | [356] | |||
107 | 3-{[2-(2-phenylethyl)phenoxy]methyl}pyridine | Drug Info | [351] | |||
108 | 4-(2-Benzylamino-ethoxy)-1,3-dihydro-indol-2-one | Drug Info | [361] | |||
109 | 4-(4-Benzyl-piperazin-1-yl)-1H-benzoimidazole | Drug Info | [362] | |||
110 | 4-(4-Benzyl-piperazin-1-yl)-1H-indole | Drug Info | [362] | |||
111 | 4-(4-Benzyl-piperazin-1-yl)-5-chloro-1H-indole | Drug Info | [362] | |||
112 | 4-(4-Benzyl-piperazin-1-yl)-7-bromo-1H-indole | Drug Info | [362] | |||
113 | 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [366] | |||
114 | 4-Benzyl-1-chroman-2-ylmethyl-piperidine | Drug Info | [334] | |||
115 | 4-Benzyl-1-chroman-3-ylmethyl-piperidine | Drug Info | [334] | |||
116 | 4-Benzyl-1-indan-2-ylmethyl-piperidine | Drug Info | [334] | |||
117 | 5-OH-DPAT | Drug Info | [367] | |||
118 | 7-(2-Amino-ethyl)-4-hydroxy-3H-benzothiazol-2-one | Drug Info | [368] | |||
119 | 7-(2-Dipropylamino-ethyl)-3H-benzothiazol-2-one | Drug Info | [368] | |||
120 | A-690344 | Drug Info | [370] | |||
121 | A-706149 | Drug Info | [371] | |||
122 | ANOLOBINE | Drug Info | [345] | |||
123 | ANONAINE | Drug Info | [345] | |||
124 | Azaperone | Drug Info | [373] | |||
125 | Benzyl-[2-(1H-indazol-4-yloxy)-ethyl]-amine | Drug Info | [361] | |||
126 | Benzyl-[2-(1H-indol-4-yloxy)-ethyl]-amine | Drug Info | [361] | |||
127 | Bis-{[R-(-)-apomorphine-2-oxy]ethyl} ether | Drug Info | [347] | |||
128 | BOLDINE | Drug Info | [359] | |||
129 | BRL-25594 | Drug Info | [374] | |||
130 | BRL-26175 | Drug Info | [375] | |||
131 | CLEBOPRIDE | Drug Info | [374] | |||
132 | D-189 | Drug Info | [376] | |||
133 | D-190 | Drug Info | [376] | |||
134 | D-192 | Drug Info | [376] | |||
135 | D-193 | Drug Info | [376] | |||
136 | D-203 | Drug Info | [376] | |||
137 | D-210 | Drug Info | [376] | |||
138 | D-218 | Drug Info | [376] | |||
139 | D-219 | Drug Info | [376] | |||
140 | D-220 | Drug Info | [376] | |||
141 | D-237 | Drug Info | [377] | |||
142 | D-264 | Drug Info | [378] | |||
143 | D-315 | Drug Info | [379] | |||
144 | D-366 | Drug Info | [367] | |||
145 | EPIDEPRIDE | Drug Info | [380] | |||
146 | Ethyl-(4,5,6,7-tetrahydro-2H-indazol-5-yl)-amine | Drug Info | [381] | |||
147 | ETICLOPRIDE | Drug Info | [382] | |||
148 | Etoloxamine | Drug Info | [235] | |||
149 | FLUANISONE | Drug Info | [383] | |||
150 | FLUMEZAPINE | Drug Info | [384] | |||
151 | FLUTROLINE | Drug Info | [385] | |||
152 | GLAUCINE | Drug Info | [345] | |||
153 | IBZM | Drug Info | [380] | |||
154 | IODOPRIDE | Drug Info | [380] | |||
155 | IODOSULPIRIDE | Drug Info | [380] | |||
156 | ISOCLOZAPINE | Drug Info | [386] | |||
157 | ISOLOXAPINE | Drug Info | [387] | |||
158 | L-741626 | Drug Info | [388] | |||
159 | MCL-515 | Drug Info | [391] | |||
160 | MCL-516 | Drug Info | [391] | |||
161 | N-(4-Dipropylaminobutyl)-4-biphenylcarboxamide | Drug Info | [394] | |||
162 | N-Benzyl-4-(2-diphenyl)-1-piperazinehexanamide | Drug Info | [390] | |||
163 | N-Ethyl-2-methylnorapomorphine hydrochloride | Drug Info | [395] | |||
164 | N-Ethyl-2-phenylnorapomorphine hydrochloride | Drug Info | [395] | |||
165 | N-Propyl-2-methylnorapomorphine hydrochloride | Drug Info | [395] | |||
166 | N-Propyl-2-phenylnorapomorphine hydrochloride | Drug Info | [395] | |||
167 | N-propylnorapomorphine | Drug Info | [396], [343] | |||
168 | NOR-ROEFRACTINE | Drug Info | [341] | |||
169 | OCTOCLOTHEPIN | Drug Info | [398] | |||
170 | PD-135111 | Drug Info | [329] | |||
171 | PD-135146 | Drug Info | [329] | |||
172 | PD-135188 | Drug Info | [329] | |||
173 | PD-135222 | Drug Info | [329] | |||
174 | PD-135385 | Drug Info | [329] | |||
175 | PD-135478 | Drug Info | [329] | |||
176 | PD-135540 | Drug Info | [329] | |||
177 | PD-137789 | Drug Info | [329] | |||
178 | PD-137821 | Drug Info | [329] | |||
179 | PD-168077 | Drug Info | [357] | |||
180 | PD-172938 | Drug Info | [400] | |||
181 | PD-172939 | Drug Info | [400] | |||
182 | PG-01037 | Drug Info | [401] | |||
183 | Preclamol | Drug Info | [364] | |||
184 | Propyl-(4,5,6,7-tetrahydro-2H-indazol-5-yl)-amine | Drug Info | [381] | |||
185 | PUKATEINE | Drug Info | [345] | |||
186 | QUINPIROLE | Drug Info | [360] | |||
187 | Ro-21-7767 | Drug Info | [403] | |||
188 | Rolicyclidine | Drug Info | [404] | |||
189 | SB-258719 | Drug Info | [405] | |||
190 | SB-271046 | Drug Info | [406] | |||
191 | SCH-24518 | Drug Info | [408] | |||
192 | SK&F-89626 | Drug Info | [410] | |||
193 | SKF-89124A | Drug Info | [368] | |||
194 | SLV-314 | Drug Info | [411] | |||
195 | SNAP-94847 | Drug Info | [412] | |||
196 | STEPHOLIDINE | Drug Info | [413] | |||
197 | UH-232 | Drug Info | [414] | |||
198 | UH-301 | Drug Info | [415] | |||
199 | WAY-208466 | Drug Info | [417] | |||
200 | [2-(1H-Benzoimidazol-4-yloxy)-ethyl]-benzyl-amine | Drug Info | [361] | |||
201 | [3H]7-OH-DPAT | Drug Info | [377] | |||
202 | [R-(-)-Apomorphine-2-yl]-(2'-hydroxy-ethyl)ether | Drug Info | [347] | |||
Agonist | [+] 55 Agonist drugs | + | ||||
1 | Apomorphine | Drug Info | [187] | |||
2 | Aripiprazole | Drug Info | [188] | |||
3 | Bromocriptine | Drug Info | [1], [191], [192] | |||
4 | Cabergoline | Drug Info | [193], [194] | |||
5 | Dihydroergotamine | Drug Info | [201] | |||
6 | Dihydroergotoxine | Drug Info | [22] | |||
7 | Dopamine | Drug Info | [204], [205] | |||
8 | Ephedrine | Drug Info | [30] | |||
9 | Ergonovine | Drug Info | [207] | |||
10 | Lisuride | Drug Info | [212], [213], [214] | |||
11 | Mephentermine | Drug Info | [218] | |||
12 | Mesoridazine | Drug Info | [219] | |||
13 | Metaraminol | Drug Info | [220] | |||
14 | Methamphetamine | Drug Info | [50] | |||
15 | Methyldopa | Drug Info | [221] | |||
16 | N-0923 | Drug Info | [106] | |||
17 | Naphazoline | Drug Info | [225] | |||
18 | Nemonapride | Drug Info | [26] | |||
19 | Olanzapine | Drug Info | [61] | |||
20 | Phenylephrine | Drug Info | [233], [234] | |||
21 | Quetiapine | Drug Info | [26], [182], [241] | |||
22 | Quinagolide | Drug Info | [242] | |||
23 | Ziprasidone | Drug Info | [253] | |||
24 | Talipexole | Drug Info | [255] | |||
25 | CQA 206-291 | Drug Info | [256] | |||
26 | Entacapone+levodopa+carbidopa | Drug Info | [257] | |||
27 | Sumanirole | Drug Info | [106] | |||
28 | Aplindore fumarate | Drug Info | [26], [266] | |||
29 | JNJ-37822681 | Drug Info | [269] | |||
30 | Pardoprunox | Drug Info | [73] | |||
31 | TBR-760 | Drug Info | [276] | |||
32 | XP-21279 | Drug Info | [277] | |||
33 | (-)-3PPP, Maryland | Drug Info | [26] | |||
34 | Carmoxirole | Drug Info | [280] | |||
35 | Lu-02-750 | Drug Info | [282] | |||
36 | Fencamfamine | Drug Info | [291] | |||
37 | NOLOMIROLE HYDROCHLORIDE | Drug Info | [299], [3] | |||
38 | SAVOXEPIN MESYLATE | Drug Info | [308], [3] | |||
39 | AM-831 | Drug Info | [310] | |||
40 | AMR-103 | Drug Info | [320] | |||
41 | Y-20024 | Drug Info | [332], [3] | |||
42 | 7-trans-OH-PIPAT | Drug Info | [369] | |||
43 | LP-12 | Drug Info | [389] | |||
44 | LP-211 | Drug Info | [390] | |||
45 | LP-44 | Drug Info | [389] | |||
46 | MLS1547 | Drug Info | [393] | |||
47 | PD 128907 | Drug Info | [399] | |||
48 | PF-03800130 | Drug Info | [265] | |||
49 | piribedil | Drug Info | [402] | |||
50 | Rotigitine | Drug Info | [13] | |||
51 | Uinagolide | Drug Info | [242] | |||
52 | UNC0006 | Drug Info | [416] | |||
53 | UNC9975 | Drug Info | [416] | |||
54 | UNC9994 | Drug Info | [416] | |||
55 | WS-50030 | Drug Info | [265] | |||
Modulator | [+] 61 Modulator drugs | + | ||||
1 | Cariprazine | Drug Info | [16] | |||
2 | Denopamine | Drug Info | [5] | |||
3 | Docarpamine | Drug Info | [5] | |||
4 | Dopexamine | Drug Info | [5] | |||
5 | Ibopamine hci | Drug Info | [5], [210] | |||
6 | Levodopa | Drug Info | [38] | |||
7 | Levomepromazine | Drug Info | [211] | |||
8 | Lurasidone hydrochloride | Drug Info | [43], [44] | |||
9 | OPC-34712 | Drug Info | [226], [227] | |||
10 | Perazine | Drug Info | [228], [3] | |||
11 | Pergolide | Drug Info | [211] | |||
12 | Piperacetazine | Drug Info | [211] | |||
13 | Pramipexole | Drug Info | [211] | |||
14 | Ropinirole | Drug Info | [211] | |||
15 | Bis(olanzapine) pamoate monohydrate | Drug Info | [3] | |||
16 | Lu AF35700 | Drug Info | [101] | |||
17 | Pridopidine | Drug Info | [260], [261] | |||
18 | RBP-7000 | Drug Info | [262] | |||
19 | Zicronapine | Drug Info | [263] | |||
20 | Sarizotan | Drug Info | [264] | |||
21 | BIM23A760 | Drug Info | [109] | |||
22 | CGS-15873A | Drug Info | [267], [3] | |||
23 | CLR-3001 | Drug Info | [268] | |||
24 | Mazapertine succinate | Drug Info | [264] | |||
25 | Ocaperidone | Drug Info | [116] | |||
26 | PD-143188 | Drug Info | [270] | |||
27 | SDZ-MAR-327 | Drug Info | [274] | |||
28 | Abaperidone | Drug Info | [278] | |||
29 | ATI-9242 | Drug Info | [279] | |||
30 | Lu-AE04621 | Drug Info | [283] | |||
31 | SSR-181507 | Drug Info | [286] | |||
32 | YKP-1358 | Drug Info | [288] | |||
33 | Bifeprunox | Drug Info | [297] | |||
34 | Sibenadet | Drug Info | [300] | |||
35 | BAM-1110 | Drug Info | [302] | |||
36 | Declopramide | Drug Info | [303] | |||
37 | FOSOPAMINE | Drug Info | [304], [3] | |||
38 | Naxagolide | Drug Info | [306] | |||
39 | PF-217830 | Drug Info | [264] | |||
40 | Romergoline | Drug Info | [307] | |||
41 | SLV-310 | Drug Info | [309] | |||
42 | DU-29894 | Drug Info | [311] | |||
43 | Ordopidine | Drug Info | [312] | |||
44 | S-18327 | Drug Info | [313] | |||
45 | SDZ-GLC-756 | Drug Info | [314] | |||
46 | SLV-313 | Drug Info | [315] | |||
47 | F-15063 | Drug Info | [316] | |||
48 | S32504 | Drug Info | [164] | |||
49 | BIMG80 | Drug Info | [321] | |||
50 | CGP-25454A | Drug Info | [322] | |||
51 | CP-903397 | Drug Info | [323] | |||
52 | E-2040 | Drug Info | [325] | |||
53 | Etrabamine | Drug Info | [326] | |||
54 | LY-243062 | Drug Info | [327] | |||
55 | NGD-93-1 | Drug Info | [328] | |||
56 | NNC-22-0031 | Drug Info | [176] | |||
57 | Org-10490 | Drug Info | [211] | |||
58 | PNU-96391A | Drug Info | [178] | |||
59 | RWJ-25730 | Drug Info | [330] | |||
60 | SDZ-208911 | Drug Info | [409], [3] | |||
61 | SEL-73 | Drug Info | [265] | |||
Binder | [+] 5 Binder drugs | + | ||||
1 | Droperidol | Drug Info | [206] | |||
2 | Molindone | Drug Info | [223], [224] | |||
3 | SKL-10406 | Drug Info | [285] | |||
4 | Y-931 | Drug Info | [26] | |||
5 | ZD-3638 | Drug Info | [26] | |||
Stimulator | [+] 2 Stimulator drugs | + | ||||
1 | Pseudoephedrine | Drug Info | [239], [240] | |||
2 | Lu AF28996 | Drug Info | [281] | |||
Ligand | [+] 11 Ligand drugs | + | ||||
1 | Aryl piperazine derivative 1 | Drug Info | [137] | |||
2 | Aryl piperazine derivative 6 | Drug Info | [137] | |||
3 | Benzo[d]oxazol-2(3H)-one derivative 1 | Drug Info | [289] | |||
4 | Benzo[d]oxazol-2(3H)-one derivative 2 | Drug Info | [289] | |||
5 | Benzo[d]oxazol-2(3H)-one derivative 3 | Drug Info | [289] | |||
6 | PMID29334795-Compound-62 | Drug Info | [289] | |||
7 | PMID29334795-Compound-66 | Drug Info | [289] | |||
8 | PMID29334795-Compound-67 | Drug Info | [289] | |||
9 | PMID30124346-Compound-13TABLE4 | Drug Info | [137] | |||
10 | PMID30124346-Compound-34TABLE4 | Drug Info | [137] | |||
11 | PMID30124346-Compound-60TABLE5 | Drug Info | [137] | |||
Modulator (allosteric modulator) | [+] 1 Modulator (allosteric modulator) drugs | + | ||||
1 | SB269652 | Drug Info | [407] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Drug Binding Sites of Target | Top | |||||
---|---|---|---|---|---|---|
Ligand Name: Bromocriptine | Ligand Info | |||||
Structure Description | Structure of a D2 dopamine receptor-G-protein complex in a lipid membrane | PDB:6VMS | ||||
Method | Electron microscopy | Resolution | 3.80 Å | Mutation | No | [421] |
PDB Sequence |
PHYNYYATLL
41 TLLIAVIVFG51 NVLVCMAVSR61 EKALQTTTNY71 LIVSLAVADL81 LVATLVMPWV 91 VYLEVVGEWK101 FSRIHCDIFV111 TLDVMMCTAS121 ILNLCAISID131 RYTAVAMPML 141 YNTRYSSKRR151 VTVMISIVWV161 LSFTISCPLL171 FGLNNADQNE181 CIIANPAFVV 191 YSSIVSFYVP201 FIVILLVYIK211 IYIVLRRRRK221 LVNTNRKLSQ365 QKEKKATQLL 375 AIYLGLFIIC385 WLPFFITHIL395 NIHCDCNIPP405 VLYSAFTWLG415 YVNSAINPII 425 YTTFNIEFRK435 AFLKILHC
|
|||||
|
LEU94
4.374
PHE110
3.541
VAL111
3.516
ASP114
2.759
VAL115
3.914
CYS118
3.425
THR119
3.464
ILE122
3.417
CYS182
3.298
ILE183
3.790
ILE184
3.505
PHE189
4.963
VAL190
3.623
|
|||||
Ligand Name: Risperidone | Ligand Info | |||||
Structure Description | Structure of the D2 Dopamine Receptor Bound to the Atypical Antipsychotic Drug Risperidone | PDB:6CM4 | ||||
Method | X-ray diffraction | Resolution | 2.87 Å | Mutation | No | [422] |
PDB Sequence |
NYYATLLTLL
44 IAVIVFGNVL54 VCMAVSREKA64 LQTTTNYLIV74 SLAVADLLVA84 TLVMPWVVYL 94 EVVGEWKFSR104 IHCDIFVTLD114 VMMCTASALN124 LCAISIDRYT134 AVAMPTRYSS 148 KRRVTVMISI158 VWVLSFTISC168 PLLFGLNNAD178 QNECIIANPA188 FVVYSSIVSF 198 YVPFIVTLLV208 YIKIYIVLRR218 RRKRNIFEML1007 RIDEGLRLKI1017 YKDTEGYYTI 1027 GIGHLLTKSP1037 SLNAAKSELD1047 KAIGRNTNGV1057 ITKDEAEKLF1067 NQDVDAAVRG 1077 ILRNAKLKPV1087 YDSLDAVRRA1097 ALINMVFQMG1107 ETGVAGFTNS1117 LRMLQQKRWD 1127 EAAVNLAKSR1137 WYNQTPNRAK1147 RVITTFRTGT1157 WDAYSQQKEK369 KATQMAAIVA 379 GVFIICWLPF389 FITHILNIHC399 DCNIPPVLYS409 AFTWLGYVNS419 AVNPIIYTTF 429 NIEFRKAFLK439 ILH
|
|||||
|
VAL91
4.442
LEU94
4.082
TRP100
3.497
PHE110
3.744
ASP114
2.694
VAL115
3.803
CYS118
3.334
THR119
3.727
ALA122
3.306
ILE184
4.478
PHE189
4.459
SER193
3.996
|
|||||
Click to View More Binding Site Information of This Target with Different Ligands |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Pathway Affiliation
Biological Network Descriptors
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
Rap1 signaling pathway | hsa04015 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
cAMP signaling pathway | hsa04024 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
|
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy | ||
Gap junction | hsa04540 | Affiliated Target |
|
Class: Cellular Processes => Cellular community - eukaryotes | Pathway Hierarchy | ||
Dopaminergic synapse | hsa04728 | Affiliated Target |
|
Class: Organismal Systems => Nervous system | Pathway Hierarchy |
Degree | 10 | Degree centrality | 1.07E-03 | Betweenness centrality | 4.80E-04 |
---|---|---|---|---|---|
Closeness centrality | 2.13E-01 | Radiality | 1.37E+01 | Clustering coefficient | 4.44E-02 |
Neighborhood connectivity | 1.42E+01 | Topological coefficient | 1.22E-01 | Eccentricity | 12 |
Download | Click to Download the Full PPI Network of This Target | ||||
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 8 KEGG Pathways | + | ||||
1 | Rap1 signaling pathway | |||||
2 | cAMP signaling pathway | |||||
3 | Neuroactive ligand-receptor interaction | |||||
4 | Gap junction | |||||
5 | Dopaminergic synapse | |||||
6 | Parkinson's disease | |||||
7 | Cocaine addiction | |||||
8 | Alcoholism | |||||
Panther Pathway | [+] 4 Panther Pathways | + | ||||
1 | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
2 | Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
3 | Dopamine receptor mediated signaling pathway | |||||
4 | Nicotine pharmacodynamics pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Dopamine receptors | |||||
2 | G alpha (i) signalling events | |||||
WikiPathways | [+] 7 WikiPathways | + | ||||
1 | Hypothetical Network for Drug Addiction | |||||
2 | Monoamine GPCRs | |||||
3 | GPCRs, Class A Rhodopsin-like | |||||
4 | Genes and (Common) Pathways Underlying Drug Addiction | |||||
5 | GPCR ligand binding | |||||
6 | GPCR downstream signaling | |||||
7 | Nicotine Activity on Dopaminergic Neurons |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Silymarin BIO-C, an extract from Silybum marianum fruits, induces hyperprolactinemia in intact female rats. Phytomedicine. 2009 Sep;16(9):839-44. | |||||
REF 2 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 012254. | |||||
REF 3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 963). | |||||
REF 5 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | |||||
REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4133). | |||||
REF 7 | Anxiolytic effects of aniracetam in three different mouse models of anxiety and the underlying mechanism. Eur J Pharmacol. 2001 May 18;420(1):33-43. | |||||
REF 8 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 33). | |||||
REF 9 | ClinicalTrials.gov (NCT02339064) Infusion of Apomorphine: Long-term Safety Study. U.S. National Institutes of Health. | |||||
REF 10 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 34). | |||||
REF 11 | Electrophysiological studies in the rat brain on the basis for aripiprazole augmentation of antidepressants in major depressive disorder. Psychopharmacology (Berl). 2009 Oct;206(2):335-44. | |||||
REF 12 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 35). | |||||
REF 13 | Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54. | |||||
REF 14 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 37). | |||||
REF 15 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7671). | |||||
REF 16 | Radium 223 dichloride for prostate cancer treatment. Drug Des Devel Ther. 2017 Sep 6;11:2643-2651. | |||||
REF 17 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 83). | |||||
REF 18 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 080439. | |||||
REF 19 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016149. | |||||
REF 20 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 534). | |||||
REF 21 | Sustained pain relief with dihydroergotamine in migraine is potentially due to persistent binding to 5-HT1B and 5-HT1D receptors. . The Journal of Headache and Pain 201314(Suppl 1):P75. | |||||
REF 22 | Pharmacologic management of Alzheimer disease, Part II: Antioxidants, antihypertensives, and ergoloid derivatives. Ann Pharmacother. 1999 Feb;33(2):188-97. | |||||
REF 23 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 965). | |||||
REF 24 | A systematic review of the efficacy of domperidone for the treatment of diabetic gastroparesis. Clin Gastroenterol Hepatol. 2008 Jul;6(7):726-33. | |||||
REF 25 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 940). | |||||
REF 26 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. | |||||
REF 27 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7172). | |||||
REF 28 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 072123. | |||||
REF 29 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 556). | |||||
REF 30 | The effect of alpha-2 adrenergic agonists on memory and cognitive flexibility. Cogn Behav Neurol. 2006 Dec;19(4):204-7. | |||||
REF 31 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 148). | |||||
REF 32 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 006035. | |||||
REF 33 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 85). | |||||
REF 34 | Drug information of Fluspirilene, 2008. eduDrugs. | |||||
REF 35 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 86). | |||||
REF 36 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 87). | |||||
REF 37 | Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92. | |||||
REF 38 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3639). | |||||
REF 39 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 43). | |||||
REF 40 | Lisuride, a dopamine receptor agonist with 5-HT2B receptor antagonist properties: absence of cardiac valvulopathy adverse drug reaction reports supports the concept of a crucial role for 5-HT2B receptor agonism in cardiac valvular fibrosis. Clin Neuropharmacol. 2006 Mar-Apr;29(2):80-6. | |||||
REF 41 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019 | |||||
REF 42 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7461). | |||||
REF 43 | Mullard A: 2010 FDA drug approvals. Nat Rev Drug Discov. 2011 Feb;10(2):82-5. | |||||
REF 44 | Pharmacological profile of lurasidone, a novel antipsychotic agent with potent 5-hydroxytryptamine 7 (5-HT7) and 5-HT1A receptor activity. J Pharmacol Exp Ther. 2010 Jul;334(1):171-81. | |||||
REF 45 | New drugs for type 2 diabetes mellitus: what is their place in therapy Drugs. 2008;68(15):2131-62. | |||||
REF 46 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7227). | |||||
REF 47 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016774. | |||||
REF 48 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7229). | |||||
REF 49 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 080722. | |||||
REF 50 | Pharmacotherapy for obesity. Drugs. 2005;65(10):1391-418. | |||||
REF 51 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5217). | |||||
REF 52 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070075. | |||||
REF 53 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 241). | |||||
REF 54 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070184. | |||||
REF 55 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 207). | |||||
REF 56 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 017111. | |||||
REF 57 | 2007 FDA drug approvals: a year of flux. Nat Rev Drug Discov. 2008 Feb;7(2):107-9. | |||||
REF 58 | Rotigotine: a novel dopamine agonist for the transdermal treatment of Parkinson's disease. Drugs Today (Barc). 2006 Jan;42(1):21-8. | |||||
REF 59 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 983). | |||||
REF 60 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 47). | |||||
REF 61 | Olanzapine: an updated review of its use in the management of schizophrenia. Drugs. 2001;61(1):111-61. | |||||
REF 62 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7672). | |||||
REF 63 | ClinicalTrials.gov (NCT01397786) Safety and Tolerability Study of Oral OPC-34712 as Maintenance Treatment in Adults With Schizophrenia. U.S. National Institutes of Health. | |||||
REF 64 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 48). | |||||
REF 65 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 209). | |||||
REF 66 | Methamphetamine Addiction and Abuse - Perphenazine. | |||||
REF 67 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 502). | |||||
REF 68 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040235. | |||||
REF 69 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019494) | |||||
REF 70 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 90). | |||||
REF 71 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 017473. | |||||
REF 72 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 953). | |||||
REF 73 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. | |||||
REF 74 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7279). | |||||
REF 75 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040058. | |||||
REF 76 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7286). | |||||
REF 77 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075153. | |||||
REF 78 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 50). | |||||
REF 79 | How many modes of action should an antibiotic have Curr Opin Pharmacol. 2008 Oct;8(5):564-73. | |||||
REF 80 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 96). | |||||
REF 81 | Emerging anxiolytics. Expert Opin Emerg Drugs. 2007 Nov;12(4):541-54. | |||||
REF 82 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7295). | |||||
REF 83 | Update on ropinirole in the treatment of Parkinson's disease. Neuropsychiatr Dis Treat. 2009;5:33-6. | |||||
REF 84 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 960). | |||||
REF 85 | Persistence and compliance to antidepressant treatment in patients with depression: a chart review. BMC Psychiatry. 2009 Jun 16;9:38. | |||||
REF 86 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7306). | |||||
REF 87 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 012753. | |||||
REF 88 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 100). | |||||
REF 89 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 088001. | |||||
REF 90 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 212). | |||||
REF 91 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070600. | |||||
REF 92 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7310). | |||||
REF 93 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 006403. | |||||
REF 94 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 59). | |||||
REF 95 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7559). | |||||
REF 96 | Drug information of Zuclopenthixol, 2008. eduDrugs. | |||||
REF 97 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7670). | |||||
REF 98 | CQA 206-291: a novel dopamine agonist in the treatment of Parkinson's disease. Clin Neuropharmacol. 1990 Aug;13(4):303-11. | |||||
REF 99 | Optimizing levodopa therapy for Parkinson's disease with levodopa/carbidopa/entacapone: implications from a clinical and patient perspective. Neuropsychiatr Dis Treat. 2008 February; 4(1): 39-47. | |||||
REF 100 | ClinicalTrials.gov (NCT05227209) A 12-Month Open-label Extension Study to Evaluate the Long-term Safety, Tolerability, and Effectiveness of SEP-4199 Controlled Release (CR) for the Treatment of Major Depressive Episode Associated With Bipolar I Disorder (Bipolar I Depression). U.S.National Institutes of Health. | |||||
REF 101 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 102 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 103 | ClinicalTrials.gov (NCT00665223) A Study of Treatment With ACR16 in Patients With Huntington's Disease. U.S. National Institutes of Health. | |||||
REF 104 | ClinicalTrials.gov (NCT02109562) Randomized, Double-blind, Placebo Controlled, Multi-center and Tolerability of RBP-7000 in Schizophrenia Patients. U.S. National Institutes of Health. | |||||
REF 105 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3949). | |||||
REF 106 | Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42. | |||||
REF 107 | ClinicalTrials.gov (NCT01295372) Safety and Efficacy of Zicronapine in Patients With Schizophrenia. U.S. National Institutes of Health. | |||||
REF 108 | ClinicalTrials.gov (NCT01857232) Dose-finding Study of APD403 to Prevent Nausea and Vomiting After Chemotherapy. U.S. National Institutes of Health. | |||||
REF 109 | BIM-23A760, a chimeric molecule directed towards somatostatin and dopamine receptors, vs universal somatostatin receptors ligands in GH-secreting pituitary adenomas partial responders to octreotide. J Endocrinol Invest. 2005;28(11 Suppl International):21-7. | |||||
REF 110 | Emerging drugs for acromegaly. Expert Opin Emerg Drugs. 2008 Jun;13(2):273-93. | |||||
REF 111 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001412) | |||||
REF 112 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032468) | |||||
REF 113 | ClinicalTrials.gov (NCT00728195) An Efficacy and Safety Study of 3 Fixed Doses of JNJ-37822681 in Participants With Schizophrenia. U.S. National Institutes of Health. | |||||
REF 114 | Orally active benzamide antipsychotic agents with affinity for dopamine D2, serotonin 5-HT1A, and adrenergic alpha1 receptors. J Med Chem. 1998 Jun 4;41(12):1997-2009. | |||||
REF 115 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 46). | |||||
REF 116 | Pharmacological profile of the new potent neuroleptic ocaperidone (R 79,598). J Pharmacol Exp Ther. 1992 Jan;260(1):146-59. | |||||
REF 117 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 118 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005971) | |||||
REF 119 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 52). | |||||
REF 120 | Roxindole: psychopharmacological profile of a dopamine D2 autoreceptor agonist. J Pharmacol Exp Ther. 1996 Jan;276(1):41-8. | |||||
REF 121 | ClinicalTrials.gov (NCT01490086) RP5063 in Subjects With Schizophrenia or Schizoaffective Disorder. U.S. National Institutes of Health. | |||||
REF 122 | Positron emission tomographic analysis of central dopamine D1 receptor binding in normal subjects treated with the atypical neuroleptic, SDZ MAR 327. Int J Mol Med. 1998 Jan;1(1):243-7. | |||||
REF 123 | ClinicalTrials.gov (NCT03543410) A Clinical Study to Test the Effectiveness of an Investigational Drug to Treat People That Have Major Depressive Episodes When They Have Bipolar 1 Depression. U.S. National Institutes of Health. | |||||
REF 124 | ClinicalTrials.gov (NCT03544229) A Study to Evaluate the Efficacy and Safety of TAK-906 in Adult Participants With Symptomatic Idiopathic or Diabetic Gastroparesis. U.S. National Institutes of Health. | |||||
REF 125 | ClinicalTrials.gov (NCT04335357) TBR-760 in Adult Patients With Non-Functioning Pituitary Adenomas. U.S. National Institutes of Health. | |||||
REF 126 | ClinicalTrials.gov (NCT01171313) A Efficacy, Safety and Pharmacokinetic Study of XP21279 and Sinemet in Parkinson's Disease Subjects. U.S. National Institutes of Health. | |||||
REF 127 | Pharmacologic properties of (-)-3PPP (preclamol) in man. J Neural Transm Gen Sect. 1992;88(3):165-75. | |||||
REF 128 | 1192U90 in animal tests that predict antipsychotic efficacy, anxiolysis, and extrapyramidal side effects. Neuropsychopharmacology. 1996 Sep;15(3):231-42. | |||||
REF 129 | Small Molecule Therapeutics for Schizophrenia, Sylvain Celanire. Page(30). | |||||
REF 130 | Pharmacokinetics and first clinical experiences with an antihypertensive dopamine (DA2) agonist. Eur Heart J. 1992 Sep;13 Suppl D:121-8. | |||||
REF 131 | ClinicalTrials.gov (NCT04291859) Interventional, Open-label, Exploratory Study, Investigating the Safety, Tolerability, Pharmacokinetics, and Efficacy of Lu AF28996 in Patients With Parkinson's Disease. U.S.National Institutes of Health. | |||||
REF 132 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031195) | |||||
REF 133 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031909) | |||||
REF 134 | ClinicalTrials.gov (NCT04541082) Phase I Study of Oral ONC206 in Recurrent and Rare Primary Central Nervous System Neoplasms. U.S. National Institutes of Health. | |||||
REF 135 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032727) | |||||
REF 136 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000698) | |||||
REF 137 | 5-HT1A receptor ligands and their therapeutic applications: review of new patents.Expert Opin Ther Pat. 2018 Sep;28(9):679-689. | |||||
REF 138 | mGlu5 negative allosteric modulators: a patent review (2013 - 2016).Expert Opin Ther Pat. 2017 Jun;27(6):691-706. | |||||
REF 139 | Caspase inhibitors: a review of recently patented compounds (2013-2015).Expert Opin Ther Pat. 2018 Jan;28(1):47-59. | |||||
REF 140 | Drug information of Fencamfamine, 2008. eduDrugs. | |||||
REF 141 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 968). | |||||
REF 142 | Behavioral responses of dopamine beta-hydroxylase knockout mice to modafinil suggest a dual noradrenergic-dopaminergic mechanism of action. Pharmacol Biochem Behav. 2008 Dec;91(2):217-22. | |||||
REF 143 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4792). | |||||
REF 144 | Pharmacology of the atypical antipsychotic remoxipride, a dopamine D2 receptor antagonist. CNS Drug Rev. 2001 Fall;7(3):265-82. | |||||
REF 145 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 98). | |||||
REF 146 | Sertindole: efficacy and safety in schizophrenia. Expert Opin Pharmacother. 2006 Sep;7(13):1825-34. | |||||
REF 147 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015146) | |||||
REF 148 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003364) | |||||
REF 149 | Anti-obesity drugs and neural circuits of feeding. Trends Pharmacol Sci. 2008 Apr;29(4):208-17. | |||||
REF 150 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005232) | |||||
REF 151 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007055) | |||||
REF 152 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002585) | |||||
REF 153 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002657) | |||||
REF 154 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025560) | |||||
REF 155 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001388) | |||||
REF 156 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000647) | |||||
REF 157 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016551) | |||||
REF 158 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001422) | |||||
REF 159 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025217) | |||||
REF 160 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009651) | |||||
REF 161 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008736) | |||||
REF 162 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026348) | |||||
REF 163 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024498) | |||||
REF 164 | S32504, a novel naphtoxazine agonist at dopamine D3/D2 receptors: II. Actions in rodent, primate, and cellular models of antiparkinsonian activity ... J Pharmacol Exp Ther. 2004 Jun;309(3):921-35. | |||||
REF 165 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6077). | |||||
REF 166 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002423) | |||||
REF 167 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025731) | |||||
REF 168 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006596) | |||||
REF 169 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004095) | |||||
REF 170 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025558) | |||||
REF 171 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027143) | |||||
REF 172 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009126) | |||||
REF 173 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003368) | |||||
REF 174 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005079) | |||||
REF 175 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002902) | |||||
REF 176 | NNC-19-1228 and NNC 22-0031, novel neuroleptics with a "mesolimbic-selective" behavioral profile. Psychopharmacology (Berl). 1997 Jan;129(2):168-78. | |||||
REF 177 | ORG 10490: A new antipsychotic drug with 5-HT2 and DA antagonistic properties. ScienceDirect, Volume 6, Issue 2, January 1992, Pages 111. | |||||
REF 178 | The dopamine stabilizer (-)-OSU6162 occupies a subpopulation of striatal dopamine D2/D3 receptors: an [(11)C]raclopride PET study in healthy human subjects. Neuropsychopharmacology. 2015 Jan;40(2):472-9. | |||||
REF 179 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001430) | |||||
REF 180 | Pharmacokinetics, Pharmacodynamics and Tolerance of SLV 307 After Single Oral Administration in Healthy Male Volunteers. Clinical Pharmacology & Therapeutics. 02/1999; 65(2). | |||||
REF 181 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001374) | |||||
REF 182 | Atypical antipsychotics: mechanism of action. Can J Psychiatry. 2002 Feb;47(1):27-38. | |||||
REF 183 | Specific therapeutic actions of acetophenazine, perphenazine, and benzquinamide in newly admitted schizophrenic patients. Clin Pharmacol Ther. 1967 Mar-Apr;8(2):249-55. | |||||
REF 184 | Mechanism of action of atypical antipsychotic drugs and the neurobiology of schizophrenia. CNS Drugs. 2006;20(5):389-409. | |||||
REF 185 | Amisulpride: a review of its use in the management of schizophrenia. CNS Drugs. 2004;18(13):933-56. | |||||
REF 186 | Anxiolytic effects of aniracetam in three different mouse models of anxiety and the underlying mechanism. Eur J Pharmacol. 2001 May 18;420(1):33-43. | |||||
REF 187 | Dopamine D(2/3) receptor occupancy of apomorphine in the nonhuman primate brain--a comparative PET study with [11C]raclopride and [11C]MNPA. Synapse. 2009 May;63(5):378-89. | |||||
REF 188 | Aripiprazole acts as a selective dopamine D2 receptor partial agonist. Expert Opin Investig Drugs. 2007 Jun;16(6):771-5. | |||||
REF 189 | Determination of bevantolol in human plasma by high performance liquid chromatography using solid phase extraction technique. Arch Pharm Res. 2007 Jul;30(7):890-7. | |||||
REF 190 | Different changes of plasma membrane beta-adrenoceptors in rat heart after chronic administration of propranolol, atenolol and bevantolol. Life Sci. 2007 Jul 12;81(5):399-404. | |||||
REF 191 | Striatal dopamine predicts outcome-specific reversal learning and its sensitivity to dopaminergic drug administration. J Neurosci. 2009 Feb 4;29(5):1538-43. | |||||
REF 192 | The behavioral toxicity of bromocriptine in patients with psychiatric illness. J Clin Psychopharmacol. 1989 Dec;9(6):417-22. | |||||
REF 193 | Role of D1 and D2 receptors in the regulation of voluntary movements. Bull Exp Biol Med. 2008 Jul;146(1):14-7. | |||||
REF 194 | Protection against paraquat and A53T alpha-synuclein toxicity by cabergoline is partially mediated by dopamine receptors. J Neurol Sci. 2009 Mar 15;278(1-2):44-53. | |||||
REF 195 | Comparison of dosage ranges of carphenazine and trifluoperazine in elderly chronic schizophrenics. Dis Nerv Syst. 1968 Oct;29(10):695-7. | |||||
REF 196 | Modulatory role of dopamine D2 receptors and fundamental role of L-type Ca2+ channels in the induction of long-term potentiation in the basolateral... Eur J Pharmacol. 2009 Mar 15;606(1-3):90-3. | |||||
REF 197 | Basolateral amygdala D1- and D2-dopaminergic system promotes the formation of long-term potentiation in the dentate gyrus of anesthetized rats. Prog Neuropsychopharmacol Biol Psychiatry. 2009 Apr 30;33(3):552-6. | |||||
REF 198 | Behavioral and neurochemical methods in research on new psychotropics. Ann Pharm Fr. 1998;56(2):54-9. | |||||
REF 199 | Potential utility of histamine H3 receptor antagonist pharmacophore in antipsychotics. Bioorg Med Chem Lett. 2009 Jan 15;19(2):538-42. | |||||
REF 200 | Effect of ibopamine on aqueous humor production in normotensive humans. Invest Ophthalmol Vis Sci. 2003 Nov;44(11):4853-8. | |||||
REF 201 | Current and prospective pharmacological targets in relation to antimigraine action. Naunyn Schmiedebergs Arch Pharmacol. 2008 Oct;378(4):371-94. | |||||
REF 202 | Screening of domperidone in wastewater by high performance liquid chromatography and solid phase extraction methods. Talanta. 2006 Jan 15;68(3):928-31. | |||||
REF 203 | The significance of disordered gastric emptying. Z Gastroenterol. 1986 Sep;24 Suppl 2:45-54. | |||||
REF 204 | The Detection of Dopamine Gene Receptors (DRD1-DRD5) Expression on Human Peripheral Blood Lymphocytes by Real Time PCR. Iran J Allergy Asthma Immunol. 2004 Dec;3(4):169-74. | |||||
REF 205 | Polymorphisms in dopamine receptor DRD1 and DRD2 genes and psychopathological and extrapyramidal symptoms in patients on long-term antipsychotic treatment. Am J Med Genet B Neuropsychiatr Genet. 2007Sep 5;144B(6):809-15. | |||||
REF 206 | Alpha-adrenergic blockade: a possible mechanism of tocolytic action of certain benzodiazepines in a postpartum rat model in vivo. Life Sci. 2003 Jan 24;72(10):1093-102. | |||||
REF 207 | Agonist profile of ergometrine (ergonovine) on a population of postsynaptic alpha-adrenoceptors. J Pharm Pharmacol. 1988 Feb;40(2):137-9. | |||||
REF 208 | Inhibition of glutamate release by fluspirilene in cerebrocortical nerve terminals (synaptosomes). Synapse. 2002 Apr;44(1):36-41. | |||||
REF 209 | Dopaminergic synapses in the matrix of the ventrolateral striatum after chronic haloperidol treatment. Synapse. 2002 Aug;45(2):78-85. | |||||
REF 210 | Ibopamine. A preliminary review of its pharmacodynamic and pharmacokinetic properties and therapeutic efficacy. Drugs. 1988 Jul;36(1):11-31. | |||||
REF 211 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
REF 212 | Fibrotic heart-valve reactions to dopamine-agonist treatment in Parkinson's disease. Lancet Neurol. 2007 Sep;6(9):826-9. | |||||
REF 213 | Medical management of levodopa-associated motor complications in patients with Parkinson's disease. CNS Drugs. 2007;21(8):677-92. | |||||
REF 214 | Tolerance to some behavioural effects of lisuride, a dopamine receptor agonist, and reverse tolerance to others, after repeated administration. Neuropharmacology. 1985 Mar;24(3):199-206. | |||||
REF 215 | Remoxipride in Parkinson's disease: differential response in patients with dyskinesias fluctuations versus psychosis. Clin Neuropharmacol. 1995 Feb;18(1):39-45. | |||||
REF 216 | Specific in vitro and in vivo binding of 3H-raclopride. A potent substituted benzamide drug with high affinity for dopamine D-2 receptors in the rat brain. Biochem Pharmacol. 1985 Jul 1;34(13):2251-9. | |||||
REF 217 | The effects of antipsychotic drugs on Fos protein expression in the prefrontal cortex: cellular localization and pharmacological characterization. Neuroscience. 1996 Jan;70(2):377-89. | |||||
REF 218 | Present state of alpha- and beta-adrenergic drugs I. The adrenergic receptor. Am Heart J. 1976 Nov;92(5):661-4. | |||||
REF 219 | Intrinsic efficacy of antipsychotics at human D2, D3, and D4 dopamine receptors: identification of the clozapine metabolite N-desmethylclozapine as... J Pharmacol Exp Ther. 2005 Dec;315(3):1278-87. | |||||
REF 220 | Alpha1-adrenoceptor stimulation enhances experimental gastric carcinogenesis induced by N-methyl-N'-nitro-N-nitrosoguanidine in Wistar rats. Int J Cancer. 1998 Jul 29;77(3):467-9. | |||||
REF 221 | Centrally acting antihypertensive agents: an update. J Clin Hypertens (Greenwich). 2007 May;9(5):399-405. | |||||
REF 222 | Mechanisms for metoclopramide-mediated sensitization and haloperidol-induced catalepsy in rats. Eur J Pharmacol. 2008 Jun 10;587(1-3):181-6. | |||||
REF 223 | Molindone for schizophrenia and severe mental illness. Cochrane Database Syst Rev. 2007 Jan 24;(1):CD002083. | |||||
REF 224 | Antipsychotic drugs which elicit little or no parkinsonism bind more loosely than dopamine to brain D2 receptors, yet occupy high levels of these receptors. Mol Psychiatry. 1998 Mar;3(2):123-34. | |||||
REF 225 | Decongestants in treatment of nasal obstruction. Otolaryngol Pol. 1999;53(3):347-52. | |||||
REF 226 | Effects of brexpiprazole, a novel serotonin-dopamine activity modulator, on phencyclidine-induced cognitive deficits in mice: a role for serotonin 5-HT1A receptors.Pharmacol Biochem Behav.2014 Sep;124:245-9. | |||||
REF 227 | Brexpiprazole: First Global Approval.Drugs.2015 Sep;75(14):1687-97. | |||||
REF 228 | Synthesis and in vitro binding of N-phenyl piperazine analogs as potential dopamine D3 receptor ligands. Bioorg Med Chem. 2005 Jan 3;13(1):77-87. | |||||
REF 229 | CYP2D6 and DRD2 genes differentially impact pharmacodynamic sensitivity and time course of prolactin response to perphenazine. Pharmacogenet Genomics. 2007 Nov;17(11):989-93. | |||||
REF 230 | A cross-validation study on the relationship between central D2 receptor occupancy and serum perphenazine concentration. Psychopharmacology (Berl). 2004 Sep;175(2):148-53. | |||||
REF 231 | Catecholamine-secreting neuroblastoma in a 4-month-old infant: perioperative management. J Clin Anesth. 2009 Feb;21(1):54-6. | |||||
REF 232 | Nesfatin-1 exerts cardiovascular actions in brain: possible interaction with the central melanocortin system. Am J Physiol Regul Integr Comp Physiol. 2009 Aug;297(2):R330-6. | |||||
REF 233 | MMP-2 induced vein relaxation via inhibition of [Ca2+]e-dependent mechanisms of venous smooth muscle contraction. Role of RGD peptides. J Surg Res. 2010 Apr;159(2):755-64. | |||||
REF 234 | Intracellular Ca2+ and adrenergic responsiveness of cardiac myocytes in streptozotocin-induced diabetes. Clin Exp Pharmacol Physiol. 1999 Apr;26(4):347-53. | |||||
REF 235 | Dopamine/serotonin receptor ligands. 9. Oxygen-containing midsized heterocyclic ring systems and nonrigidized analogues. A step toward dopamine D5 ... J Med Chem. 2004 Aug 12;47(17):4155-8. | |||||
REF 236 | [The benzamides tiapride, sulpiride, and amisulpride in treatment for Tourette's syndrome]. Nervenarzt. 2007 Mar;78(3):264, 266-8, 270-1. | |||||
REF 237 | In vitro and in vivo characteristics of prochlorperazine oral disintegrating film. Int J Pharm. 2009 Feb 23;368(1-2):98-102. | |||||
REF 238 | Tardive dyskinesia as a result of long-term prochlorperazine use. South Med J. 1996 Oct;89(10):989-91. | |||||
REF 239 | Cetirizine/pseudoephedrine. Drugs. 2001;61(15):2231-40; discussion 2241-2. | |||||
REF 240 | Drugs for cough and cold symptoms in hypertensive patients. Am Fam Physician. 1985 Mar;31(3):183-7. | |||||
REF 241 | Receptor reserve-dependent properties of antipsychotics at human dopamine D2 receptors. Eur J Pharmacol. 2009 Apr 1;607(1-3):35-40. | |||||
REF 242 | Effect of dopamine receptor agonists on sensory nerve activity: possible therapeutic targets for the treatment of asthma and COPD. Br J Pharmacol. 2002 Jun;136(4):620-8. | |||||
REF 243 | Randomized clinical comparison of perospirone and risperidone in patients with schizophrenia: Kansai Psychiatric Multicenter Study. Psychiatry Clin Neurosci. 2009 Jun;63(3):322-8. | |||||
REF 244 | Upcoming agents for the treatment of schizophrenia: mechanism of action, efficacy and tolerability. Drugs. 2008;68(16):2269-92. | |||||
REF 245 | The treatment of Tourette's syndrome: current opinions. Expert Opin Pharmacother. 2002 Jul;3(7):899-914. | |||||
REF 246 | D(2) dopamine receptors enable delta(9)-tetrahydrocannabinol induced memory impairment and reduction of hippocampal extracellular acetylcholine concentration. Br J Pharmacol. 2000 Jul;130(6):1201-10. | |||||
REF 247 | Antiemetic specificity of dopamine antagonists. Psychopharmacology (Berl). 1982;78(3):210-3. | |||||
REF 248 | Torecan-induced neuroleptic malignant syndrome. Harefuah. 1990 May 15;118(10):576-8. | |||||
REF 249 | Antipsychotics lack alpha 1A/B adrenoceptor subtype selectivity in the rat. Eur Neuropsychopharmacol. 2005 Mar;15(2):231-4. | |||||
REF 250 | Models of drug treatment in the attention deficit disorder with hyperactivity. Rev Neurol. 2002 Feb;34 Suppl 1:S98-S106. | |||||
REF 251 | Dopaminergic stimulation of cAMP accumulation in cultured rat mesangial cells. Am J Physiol. 1987 Aug;253(2 Pt 2):H358-64. | |||||
REF 252 | Comparative effects of tolazoline and nitroprusside on human isolated radial artery. Ann Thorac Surg. 2006 Jan;81(1):125-31. | |||||
REF 253 | Striatal and extrastriatal D2/D3-receptor-binding properties of ziprasidone: a positron emission tomography study with [18F]Fallypride and [11C]raclopride (D2/D3-receptor occupancy of ziprasidone). JClin Psychopharmacol. 2008 Dec;28(6):608-17. | |||||
REF 254 | An ethopharmacological assessment of the effects of zuclopenthixol on agonistic interactions in male mice. Methods Find Exp Clin Pharmacol. 1999 Jan-Feb;21(1):11-5. | |||||
REF 255 | Effects of talipexole on emesis-related changes in abdominal afferent vagal activity and ileal serotonin metabolism in rats. Res Commun Mol Pathol Pharmacol. 1997 Jan;95(1):67-82. | |||||
REF 256 | The antiparkinsonian activity of CQA 206-291, a new D2 dopamine receptor agonist. Clin Neuropharmacol. 1989 Feb;12(1):55-9. | |||||
REF 257 | Emerging drugs for restless legs syndrome. Expert Opin Emerg Drugs. 2005 Aug;10(3):537-52. | |||||
REF 258 | Discovery of Nonracemic Amisulpride to Maximize Benefit/Risk of 5-HT7 and D2 Receptor Antagonism for the Treatment of Mood Disorders. Clin Pharmacol Ther. 2021 Sep;110(3):808-815. | |||||
REF 259 | Pharmacology of pramipexole, a dopamine D3-preferring agonist useful in treating Parkinson's disease. Clin Neuropharmacol. 1998 May-Jun;21(3):141-51. | |||||
REF 260 | Efficacy and safety of the dopaminergic stabilizer Pridopidine (ACR16) in patients with Huntington's disease. Clin Neuropharmacol. 2010 Sep-Oct;33(5):260-4. | |||||
REF 261 | Synthesis and evaluation of a set of 4-phenylpiperidines and 4-phenylpiperazines as D2 receptor ligands and the discovery of the dopaminergic stabi... J Med Chem. 2010 Mar 25;53(6):2510-20. | |||||
REF 262 | Population pharmacokinetics and prediction of dopamine D2 receptor occupancy after multiple doses of RBP-7000, a new sustained-release formulation of risperidone, in schizophrenia patients on stable oral risperidone treatment. Clin Pharmacokinet. 2014 Jun;53(6):533-43. | |||||
REF 263 | Clinical pipeline report, company report or official report of Lundbeck. | |||||
REF 264 | Dual ligands targeting dopamine D2 and serotonin 5-HT1A receptors as new antipsychotical or anti-Parkinsonian agents.Curr Med Chem.2014;21(4):437-57. | |||||
REF 265 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 215). | |||||
REF 266 | Aplindore (DAB-452), a high affinity selective dopamine D2 receptor partial agonist. Eur J Pharmacol. 2006 Dec 15;552(1-3):36-45. | |||||
REF 267 | Biochemical and pharmacological characterization of the putative dopamine autoreceptor agonist benzopyranopyridine, CGS 15873A. Article first published online: 5 OCT 2004. | |||||
REF 268 | Clinical pipeline report, company report or official report of Clera Inc. | |||||
REF 269 | Population pharmacokinetics of JNJ-37822681, a selective fast-dissociating dopamine D receptor antagonist, in healthy subjects and subjects with schizophrenia and dose selection based on simulated D receptor occupancy. Clin Pharmacokinet. 2013 Nov;52(11):1005-15. | |||||
REF 270 | Anxiolytic effects of dopamine receptor ligands: I. Involvement of dopamine autoreceptors. Life Sci. 1998;62(7):649-63. | |||||
REF 271 | Indolebutylamines as selective 5-HT(1A) agonists. J Med Chem. 2004 Sep 9;47(19):4677-83. | |||||
REF 272 | Drug Development in Schizophrenia: Summary and Table. Pharmaceutical Medicine October 2014, Volume 28, Issue 5, pp 265-271 | |||||
REF 273 | EFFICACY AND SAFETY OF NOVEL DOPAMINE SEROTONIN STABILIZER RP 5063 IN ACUTE SCHIZOPHRENIA AND SCHIZOAFFECTIVE DISORDER. Schizophrenia Research Volume 153, Supplement 1, April 2014, Pages S22. | |||||
REF 274 | DOI: 10.1038/sj.mp.4002062 | |||||
REF 275 | Safety, Pharmacokinetics, and Pharmacodynamics of Trazpiroben (TAK-906), a Novel Selective D 2 /D 3 Receptor Antagonist: A Phase 1 Randomized, Placebo-Controlled Single- and Multiple-Dose Escalation Study in Healthy Participants. Clin Pharmacol Drug Dev. 2021 Jan 18. | |||||
REF 276 | TBR-760, a Dopamine-Somatostatin Compound, Arrests Growth of Aggressive Nonfunctioning Pituitary Adenomas in Mice. Endocrinology. 2020 Aug 1;161(8):bqaa101. | |||||
REF 277 | Double-blind study of the actively transported levodopa prodrug XP21279 in Parkinson's disease. Mov Disord. 2014 Jan;29(1):75-82. | |||||
REF 278 | 7-[3-(1-piperidinyl)propoxy]chromenones as potential atypical antipsychotics. 2. Pharmacological profile of 7-[3-[4-(6-fluoro-1, 2-benzisoxazol-3-yl)-piperidin-1-yl]propoxy]-3-(hydroxymeth yl)chromen -4-one (abaperidone, FI-8602). J Med Chem. 1998 Dec 31;41(27):5402-9. | |||||
REF 279 | Pharmacological characteristics of ATI-9242, a Novel Atypical Antipsychotic. FASEB J, April, 2010, 24(Meeting Abstract Supplement),773.12. | |||||
REF 280 | Neurohumoral response to carmoxirole, a selective dopamine (D2) receptor agonist, in patients with chronic moderate heart failure. Cardiovasc Drugs Ther. 1998 Sep;12(4):387-94. | |||||
REF 281 | Clinical pipeline report, company report or official report of Lundbeck | |||||
REF 282 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031195) | |||||
REF 283 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031909) | |||||
REF 284 | ONC206, an Imipridone Derivative, Induces Cell Death Through Activation of the Integrated Stress Response in Serous Endometrial Cancer In Vitro. Front Oncol. 2020 Oct 20;10:577141. | |||||
REF 285 | Bi-directional modulation of BNST neurons by 5-HT: Molecular expression and functional properties of excitatory 5-HT receptor subtypes. Neuroscience. 2009 December 29; 164(4): 1776-1793. | |||||
REF 286 | SSR181507, a dopamine D receptor and 5-HT() receptor ligand: evidence for mixed anxiolytic- and antidepressant-like activities.Pharmacol Biochem Behav.2011 Jan;97(3):428-35. | |||||
REF 287 | The effects of umespirone as a potential anxiolytic and antipsychotic agent. Pharmacol Biochem Behav. 1991 Sep;40(1):89-96. | |||||
REF 288 | Modeling of brain D2 receptor occupancy-plasma concentration relationships with a novel antipsychotic, YKP1358, using serial PET scans in healthy volunteers. Clin Pharmacol Ther. 2007 Feb;81(2):252-8. | |||||
REF 289 | Progress in the development of histamine H3 receptor antagonists/inverse agonists: a patent review (2013-2017).Expert Opin Ther Pat. 2018 Mar;28(3):175-196. | |||||
REF 290 | Novel serotonin receptor 2 (5-HT2R) agonists and antagonists: a patent review (2004-2014).Expert Opin Ther Pat. 2016;26(1):89-106. | |||||
REF 291 | Dopamine uptake inhibiting versus dopamine releasing properties of fencamfamine: an in vitro study. Biochem Pharmacol. 1983 Aug 1;32(15):2329-31. | |||||
REF 292 | A role for medial prefrontal dopaminergic innervation in instrumental conditioning. J Neurosci. 2009 May 20;29(20):6599-606. | |||||
REF 293 | Pharmacologically induced, subsecond dopamine transients in the caudate-putamen of the anesthetized rat. Synapse. 2007 Jan;61(1):37-9. | |||||
REF 294 | Dopamine D2 receptors: a potential pharmacological target for nomifensine and tranylcypromine but not other antidepressant treatments. Pharmacol Biochem Behav. 1995 Aug;51(4):565-9. | |||||
REF 295 | Effect of sertindole on extracellular dopamine, acetylcholine, and glutamate in the medial prefrontal cortex of conscious rats: a comparison with r... Psychopharmacology (Berl). 2009 Sep;206(1):39-49. | |||||
REF 296 | Dopamine D2(High) receptors moderately elevated by sertindole. Synapse. 2008 May;62(5):389-93. | |||||
REF 297 | Bifeprunox: a partial agonist at dopamine D2 and serotonin 1A receptors, influences nicotine-seeking behaviour in response to drug-associated stimuli in rats.Addict Biol.2012 Mar;17(2):274-86. | |||||
REF 298 | Emerging drugs for bipolar disorder. Expert Opin Emerg Drugs. 2006 Nov;11(4):621-34. | |||||
REF 299 | Effect of nolomirole on monocrotaline-induced heart failure. Pharmacol Res. 2004 Jan;49(1):1-5. | |||||
REF 300 | The role of the novel D2/beta2-agonist, Viozan (sibenadet HCl), in the treatment of symptoms of chronic obstructive pulmonary disease: results of a... Respir Med. 2003 Jan;97 Suppl A:S23-33. | |||||
REF 301 | 3-Benzisothiazolylpiperazine derivatives as potential atypical antipsychotic agents. J Med Chem. 1996 Jan 5;39(1):143-8. | |||||
REF 302 | Therapeutic effects of dopamine D1/D2 receptor agonists on detrusor hyperreflexia in 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine-lesioned parkinso... J Pharmacol Exp Ther. 1998 Jul;286(1):228-33. | |||||
REF 303 | Pharmacokinetics and central nervous system toxicity of declopramide (3-chloroprocainamide) in rats and mice. Anticancer Drugs. 1999 Jan;10(1):79-88. | |||||
REF 304 | Development of dopaminergic drugs for the chronic treatment of congestive heart failure. J Auton Pharmacol. 1990;10 Suppl 1:s85-93. | |||||
REF 305 | A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem. 1994 Apr 15;37(8):1060-2. | |||||
REF 306 | Comparison between the pharmacology of dopamine receptors mediating the inhibition of cell firing in rat brain slices through the substantia nigra pars compacta and ventral tegmental area. Br J Pharmacol. 1994 Jul;112(3):873-80. | |||||
REF 307 | CA patent application no. 648479, Implants for the treatment of dopamine associated states. | |||||
REF 308 | Savoxepine: striatal dopamine-D2 receptor occupancy in human volunteers measured using positron emission tomography (PET). Eur J Clin Pharmacol. 1993;44(2):135-40. | |||||
REF 309 | SLV310, a novel, potential antipsychotic, combining potent dopamine D2 receptor antagonism with serotonin reuptake inhibition. Bioorg Med Chem Lett. 2003 Feb 10;13(3):405-8. | |||||
REF 310 | Clinical pipeline report, company report or official report of Avarx. | |||||
REF 311 | A comparison of the neuro-endocrinological and temperature effects of DU 29894, flesinoxan, sulpiride and haloperidol in normal volunteers. Br J Clin Pharmacol. 1995 Jan;39(1):7-14. | |||||
REF 312 | The dopaminergic stabilizers pridopidine and ordopidine enhance cortico-striatal Arc gene expression. J Neural Transm. 2014 Nov;121(11):1337-47. | |||||
REF 313 | S18327 (1-[2-[4-(6-fluoro-1, 2-benzisoxazol-3-yl)piperid-1-yl]ethyl]3-phenyl imidazolin-2-one), a novel, potential antipsychotic displaying marked antagonist properties at alpha(1)- and alpha(2)-adrenergic receptors: I. Receptorial, neurochemical, and electrophysiological profile. J Pharmacol Exp Ther. 2000 Jan;292(1):38-53. | |||||
REF 314 | SDZ GLC 756, a novel octahydrobenzo[g]quinoline derivative exerts opposing effects on dopamine D1 and D2 receptors. J Neural Transm. 1996;103(1-2):17-30. | |||||
REF 315 | Synthesis and dual D2 and 5-HT1A receptor binding affinities of 7-piperazinyl and 7-piperidinyl-3,4-dihydroquinazolin-2(1H)-ones. Med Chem. 2014;10(5):484-96. | |||||
REF 316 | F15063, a potential antipsychotic with dopamine D(2)/D(3) antagonist, 5-HT(1A) agonist and D(4) partial agonist properties: (IV) duration of brain D2-like receptor occupancy and antipsychotic-like activity versus plasma concentration in mice.Naunyn Schmiedebergs Arch Pharmacol.2007 Jun;375(4):241-50. | |||||
REF 317 | Schizophrenia, "just the facts" 5. Treatment and prevention. Past, present, and future. Schizophr Res. 2010 Sep;122(1-3):1-23. | |||||
REF 318 | (1R,3S)-1-(aminomethyl)-3,4-dihydro-5,6-dihydroxy-3-phenyl-1H-2-benzopyran: a potent and selective D1 agonist. J Med Chem. 1990 Nov;33(11):2948-50. | |||||
REF 319 | Designed multiple ligands. An emerging drug discovery paradigm. J Med Chem. 2005 Oct 20;48(21):6523-43. | |||||
REF 320 | ACP-103, a 5-HT2A/2C inverse agonist, potentiates haloperidol-induced dopamine release in rat medial prefrontal cortex and nucleus accumbens. Psychopharmacology (Berl). 2005 Dec;183(2):144-53. | |||||
REF 321 | BIMG 80, a novel potential antipsychotic drug: evidence for multireceptor actions and preferential release of dopamine in prefrontal cortex. J Neurochem. 1997 Jul;69(1):182-90. | |||||
REF 322 | CGP 25454A, a novel and selective presynaptic dopamine autoreceptor antagonist. Naunyn Schmiedebergs Arch Pharmacol. 1994 Sep;350(3):230-8. | |||||
REF 323 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025558) | |||||
REF 324 | Potent activation of dopamine D3/D2 heterodimers by the antiparkinsonian agents, S32504, pramipexole and ropinirole. J Neurochem. 2003 Nov;87(3):631-41. | |||||
REF 325 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009126) | |||||
REF 326 | WO patent application no. 2009,0568,11, Medicaments. | |||||
REF 327 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005079) | |||||
REF 328 | Dopamine D4 receptors in human postmortem brain tissue of normal and schizophrenic subjects. An [3]NGD-94-1 study. Schizophrenia Research Volume 29, Issues 1-2, January 1998, Pages 93. | |||||
REF 329 | Synthesis and pharmacological evaluation of the enantiomers of the dopamine autoreceptor agonist PD 135385, Bioorg. Med. Chem. Lett. 3(4):639-644 (1993). | |||||
REF 330 | Piperazinylalkyl heterocycles as potential antipsychotic agents. J Med Chem. 1995 Oct 13;38(21):4198-210. | |||||
REF 331 | Development and validation of a capillary electrophoresis method for the enantiomeric purity determination of SLV307, a basic potential antipsychotic compound. Electrophoresis. 2004 Aug;25(16):2854-9. | |||||
REF 332 | Neuroleptic properties of Y-20024, a new benzofurancarboxamide derivative. Nihon Yakurigaku Zasshi. 1989 Nov;94(5):269-80. | |||||
REF 333 | Displacement activity of bisbenzylisoquinoline alkaloids at striatal 3H-SCH 23390 and 3H-raclopride binding sites. J Nat Prod. 1992 Sep;55(9):1281-6. | |||||
REF 334 | Synthesis and structure-activity relationships of 1-aralkyl-4-benzylpiperidine and 1-aralkyl-4-benzylpiperazine derivatives as potent sigma ligands. J Med Chem. 2005 Jan 13;48(1):266-73. | |||||
REF 335 | Functional correlates of dopamine D3 receptor activation in the rat in vivo and their modulation by the selective antagonist, (+)-S 14297: 1. Activation of postsynaptic D3 receptors mediates hypothermia, whereas blockade of D2 receptors elicits prolactin secretion and catalepsy. J Pharmacol Exp Ther. 1995 Nov;275(2):885-98. | |||||
REF 336 | Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. | |||||
REF 337 | Substituted 3-phenylpiperidines: new centrally acting dopamine autoreceptor antagonists. J Med Chem. 1993 Oct 15;36(21):3188-96. | |||||
REF 338 | Conjugated enynes as nonaromatic catechol bioisosteres: synthesis, binding experiments, and computational studies of novel dopamine receptor agonis... J Med Chem. 2000 Feb 24;43(4):756-62. | |||||
REF 339 | Specific targeting of peripheral serotonin 5-HT(3) receptors. Synthesis, biological investigation, and structure-activity relationships. J Med Chem. 2009 Jun 11;52(11):3548-62. | |||||
REF 340 | 3-amino-3,4-dihydro-2H-1-benzopyran derivatives as 5-HT1A receptor ligands and potential anxiolytic agents. 2. Synthesis and quantitative structure... J Med Chem. 1996 Oct 11;39(21):4285-98. | |||||
REF 341 | Synthesis and dopamine receptor selectivity of the benzyltetrahydroisoquinoline, (R)-(+)-nor-roefractine. J Nat Prod. 1998 Jun 26;61(6):709-12. | |||||
REF 342 | R-(-)-N-alkyl-11-hydroxy-10-hydroxymethyl- and 10-methyl-aporphines as 5-HT1A receptor ligands. Bioorg Med Chem Lett. 2007 Aug 1;17(15):4128-30. | |||||
REF 343 | Synthesis and dopamine receptor affinities of N-alkyl-11-hydroxy-2-methoxynoraporphines: N-alkyl substituents determine D1 versus D2 receptor selec... J Med Chem. 2008 Feb 28;51(4):983-7. | |||||
REF 344 | Synthesis and neuropharmacological evaluation of 2-aryl- and alkylapomorphines. Bioorg Med Chem. 2008 Apr 1;16(7):3773-9. | |||||
REF 345 | Advances in development of dopaminergic aporphinoids. J Med Chem. 2007 Jan 25;50(2):171-81. | |||||
REF 346 | Synthesis and dopamine receptor affinities of enantiomers of 2-substituted apomorphines and their N-n-propyl analogues. J Med Chem. 1990 Jun;33(6):1800-5. | |||||
REF 347 | Synthesis and neuropharmacological characterization of 2-O-substituted apomorphines. Bioorg Med Chem. 2008 Apr 15;16(8):4563-8. | |||||
REF 348 | Discovery of bishomo(hetero)arylpiperazines as novel multifunctional ligands targeting dopamine D(3) and serotonin 5-HT(1A) and 5-HT(2A) receptors. J Med Chem. 2010 Jun 24;53(12):4803-7. | |||||
REF 349 | Synthesis and biological investigations of dopaminergic partial agonists preferentially recognizing the D4 receptor subtype. Bioorg Med Chem Lett. 2006 Jun 1;16(11):2955-9. | |||||
REF 350 | Synthesis of novel lactam derivatives and their evaluation as ligands for the dopamine receptors, leading to a D(4)-selective ligand. Bioorg Med Chem. 2007 Sep 1;15(17):5811-8. | |||||
REF 351 | Arylmethyloxyphenyl derivatives: small molecules displaying P-glycoprotein inhibition. J Med Chem. 2006 Nov 2;49(22):6607-13. | |||||
REF 352 | Synthesis and pharmacological evaluation of 1-(aminomethyl)-3,4-dihydro-5-hydroxy-1H-2-benzopyrans as dopamine D1 selective ligands. J Med Chem. 1991 Oct;34(10):2946-53. | |||||
REF 353 | Piperidinylpyrroles: design, synthesis and binding properties of novel and selective dopamine D4 receptor ligands. Bioorg Med Chem Lett. 1999 Nov 1;9(21):3143-6. | |||||
REF 354 | Affinity of 10-(4-methylpiperazino)dibenz[b,f]oxepins for clozapine and spiroperidol binding sites in rat brain. J Med Chem. 1982 Jul;25(7):855-8. | |||||
REF 355 | D4 dopamine receptor-selective compounds from the Chinese plant Phoebe chekiangensis, Bioorg. Med. Chem. Lett. 7(9):1207-1212 (1997). | |||||
REF 356 | Regioselective synthesis of 3-aryl substituted pyrrolidines via palladium catalyzed arylation: pharmacological evaluation for central dopaminergic and serotonergic activity, Bioorg. Med. Chem. Lett. 7(3):241-246 (1997). | |||||
REF 357 | New N-n-propyl-substituted 3-aryl- and 3-cyclohexylpiperidines as partial agonists at the D4 dopamine receptor. J Med Chem. 2003 Jan 2;46(1):161-8. | |||||
REF 358 | Synthesis and evaluation of 1,2,3,4-tetrahydro[1]benzothieno[2,3-h]isoquinolines as dopamine antagonists. J Med Chem. 1981 Sep;24(9):1107-10. | |||||
REF 359 | Halogenated boldine derivatives with enhanced monoamine receptor selectivity. J Nat Prod. 2000 Apr;63(4):480-4. | |||||
REF 360 | N-n-Propyl-substituted 3-(dimethylphenyl)piperidines display novel discriminative properties between dopamine receptor subtypes: synthesis and rece... J Med Chem. 1998 Dec 3;41(25):4933-8. | |||||
REF 361 | New generation dopaminergic agents. 7. Heterocyclic bioisosteres that exploit the 3-OH-phenoxyethylamine D2 template. Bioorg Med Chem Lett. 1999 Sep 6;9(17):2593-8. | |||||
REF 362 | New generation dopaminergic agents. 5. Heterocyclic bioisosteres that exploit the 3-OH-N1-phenylpiperazine dopaminergic template. Bioorg Med Chem Lett. 1998 Oct 6;8(19):2675-80. | |||||
REF 363 | 3-((4-(4-Chlorophenyl)piperazin-1-yl)-methyl)-1H-pyrrolo-2,3-b-pyridine: an antagonist with high affinity and selectivity for the human dopamine D4... J Med Chem. 1996 May 10;39(10):1941-2. | |||||
REF 364 | Pre- and postsynaptic dopaminergic activities of indolizidine and quinolizidine derivatives of 3-(3-hydroxyphenyl)-N-(n-propyl)piperidine (3-PPP). ... J Med Chem. 1990 Mar;33(3):1015-22. | |||||
REF 365 | 6-Hydroxy-3-n-propyl-2,3,4,5-tetrahydro-1H-3-benzazepine and analogs: new centrally acting 5-HT1A receptor agonists. J Med Chem. 1992 Oct 30;35(22):3984-90. | |||||
REF 366 | Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97. | |||||
REF 367 | Development of (S)-N6-(2-(4-(isoquinolin-1-yl)piperazin-1-yl)ethyl)-N6-propyl-4,5,6,7-tetrahydrobenzo[d]-thiazole-2,6-diamine and its analogue as a... J Med Chem. 2010 Feb 11;53(3):1023-37. | |||||
REF 368 | Synthesis and evaluation of non-catechol D-1 and D-2 dopamine receptor agonists: benzimidazol-2-one, benzoxazol-2-one, and the highly potent benzot... J Med Chem. 1987 Jul;30(7):1166-76. | |||||
REF 369 | Iodinated 2-aminotetralins and 3-amino-1-benzopyrans: ligands for dopamine D2 and D3 receptors. J Med Chem. 1994 Nov 25;37(24):4245-50. | |||||
REF 370 | Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: 1H-pyrimidin-2-one derivatives. Bioorg Med Chem Lett. 2006 Feb;16(3):490-4. | |||||
REF 371 | Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: Quinolin(di)one and benzazepin(di)one derivatives. herve.genes... Bioorg Med Chem Lett. 2006 Feb;16(3):658-62. | |||||
REF 372 | Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54. | |||||
REF 373 | Evaluation of the effects of the enantiomers of reduced haloperidol, azaperol, and related 4-amino-1-arylbutanols on dopamine and sigma receptors. J Med Chem. 1993 Nov 26;36(24):3929-36. | |||||
REF 374 | Synthesis and structure-affinity relationships of novel N-(1-ethyl-4-methylhexahydro-1,4-diazepin-6-yl)pyridine-3-carboxamides with potent serotoni... J Med Chem. 2003 Feb 27;46(5):702-15. | |||||
REF 375 | 18F-labeled benzamides for studying the dopamine D2 receptor with positron emission tomography. J Med Chem. 1993 Nov 12;36(23):3707-20. | |||||
REF 376 | Bioisosteric heterocyclic versions of 7-{[2-(4-phenyl-piperazin-1-yl)ethyl]propylamino}-5,6,7,8-tetrahydronaphthalen-2-ol: identification of highly... J Med Chem. 2008 May 22;51(10):3005-19. | |||||
REF 377 | Structurally constrained hybrid derivatives containing octahydrobenzo[g or f]quinoline moieties for dopamine D2 and D3 receptors: binding character... J Med Chem. 2008 Dec 25;51(24):7806-19. | |||||
REF 378 | Investigation of various N-heterocyclic substituted piperazine versions of 5/7-{[2-(4-aryl-piperazin-1-yl)-ethyl]-propyl-amino}-5,6,7,8-tetrahydro-... Bioorg Med Chem. 2009 Jun 1;17(11):3923-33. | |||||
REF 379 | Further delineation of hydrophobic binding sites in dopamine D(2)/D(3) receptors for N-4 substituents on the piperazine ring of the hybrid template... Bioorg Med Chem. 2010 Aug 1;18(15):5661-74. | |||||
REF 380 | Fluorinated and iodinated dopamine agents: D2 imaging agents for PET and SPECT. J Med Chem. 1993 Jan 22;36(2):221-8. | |||||
REF 381 | Substituted 5-amino-4,5,6,7-tetrahydroindazoles as partial ergoline structures with dopaminergic activity. J Med Chem. 1989 Oct;32(10):2388-96. | |||||
REF 382 | Potential antipsychotic agents 5. Synthesis and antidopaminergic properties of substituted 5,6-dimethoxysalicylamides and related compounds. J Med Chem. 1990 Apr;33(4):1155-63. | |||||
REF 383 | 2-Phenylpyrroles as conformationally restricted benzamide analogues. A new class of potential antipsychotics. 1. J Med Chem. 1987 Nov;30(11):2099-104. | |||||
REF 384 | Synthesis and pharmacological evaluation of a series of 4-piperazinylpyrazolo[3,4-b]- and -[4,3-b][1,5]benzodiazepines as potential anxiolytics. J Med Chem. 1989 Dec;32(12):2573-82. | |||||
REF 385 | Neuroleptic activity in 5-aryltetrahydro-gamma-carbolines. J Med Chem. 1980 Jun;23(6):635-43. | |||||
REF 386 | Synthesis and pharmacological evaluation of triflate-substituted analogues of clozapine: identification of a novel atypical neuroleptic. J Med Chem. 1997 Dec 5;40(25):4146-53. | |||||
REF 387 | Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. J Med Chem. 1981 Sep;24(9):1021-6. | |||||
REF 388 | Synthesis and characterization of selective dopamine D2 receptor antagonists. 2. Azaindole, benzofuran, and benzothiophene analogs of L-741,626. Bioorg Med Chem. 2010 Jul 15;18(14):5291-300. | |||||
REF 389 | Structure-activity relationship study on N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides, a class of 5-HT7 receptor agents. 2. J Med Chem. 2007 Aug 23;50(17):4214-21. | |||||
REF 390 | Structural modifications of N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides: influence on lipophilicity and 5-HT7 receptor act... J Med Chem. 2008 Sep 25;51(18):5813-22. | |||||
REF 391 | Synthesis and neuropharmacological evaluation of esters of R(-)-N-alkyl-11-hydroxy-2-methoxynoraporphines. Bioorg Med Chem Lett. 2009 Jan 1;19(1):51-3. | |||||
REF 392 | Discovery, optimization, and characterization of a novel series of dopamine D2 versus D3 receptor selective antagonists. Probe Reports from the NIH Molecular Libraries Program [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2010. | |||||
REF 393 | Discovery and characterization of a G protein-biased agonist that inhibits beta-arrestin recruitment to the D2 dopamine receptor. Mol Pharmacol. 2014 Jul;86(1):96-105. | |||||
REF 394 | Novel D3 selective dopaminergics incorporating enyne units as nonaromatic catechol bioisosteres: synthesis, bioactivity, and mutagenesis studies. J Med Chem. 2008 Nov 13;51(21):6829-38. | |||||
REF 395 | N-Substituted-2-alkyl- and 2-arylnorapomorphines: novel, highly active D2 agonists. Bioorg Med Chem. 2009 Jul 1;17(13):4756-62. | |||||
REF 396 | A functional test identifies dopamine agonists selective for D3 versus D2 receptors. Neuroreport. 1995 Jan 26;6(2):329-32. | |||||
REF 397 | Nafadotride, a potent preferential dopamine D3 receptor antagonist, activates locomotion in rodents. J Pharmacol Exp Ther. 1995 Dec;275(3):1239-46. | |||||
REF 398 | Exploring the neuroleptic substituent in octoclothepin: potential ligands for positron emission tomography with subnanomolar affinity for (1)-adre... J Med Chem. 2010 Oct 14;53(19):7021-34. | |||||
REF 399 | Neurochemical and functional characterization of the preferentially selective dopamine D3 agonist PD 128907. J Pharmacol Exp Ther. 1995 Dec;275(3):1355-66. | |||||
REF 400 | Isoindolinone enantiomers having affinity for the dopamine D4 receptor. Bioorg Med Chem Lett. 1998 Jun 16;8(12):1499-502. | |||||
REF 401 | Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3... J Med Chem. 2007 Aug 23;50(17):4135-46. | |||||
REF 402 | Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther. 2002 Nov;303(2):791-804. | |||||
REF 403 | Evaluation of cis- and trans-9- and 11-hydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridines as structurally rigid, selective D1 dopamine recepto... J Med Chem. 1995 Jan 20;38(2):318-27. | |||||
REF 404 | 4-Acetoxy-7-chloro-3-(3-(-4-[11C]methoxybenzyl)phenyl)-2(1H)-quinolone Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. | |||||
REF 405 | Atropisomeric derivatives of 2',6'-disubstituted (R)-11-phenylaporphine: selective serotonin 5-HT(7) receptor antagonists. J Med Chem. 2001 Apr 26;44(9):1337-40. | |||||
REF 406 | Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. | |||||
REF 407 | A new mechanism of allostery in a G protein-coupled receptor dimer. Nat Chem Biol. 2014 Sep;10(9):745-52. | |||||
REF 408 | Synthesis and pharmacological characterization of 1-phenyl-, 4-phenyl-, and 1-benzyl-1,2,3,4-tetrahydroisoquinolines as dopamine receptor ligands. J Med Chem. 1988 Oct;31(10):1941-6. | |||||
REF 409 | Effects of the partial dopamine receptor agonists SDZ 208-911, SDZ 208-912 and terguride on central monoamine receptors. A behavioral, biochemical and electrophysiological study. Naunyn SchmiedebergsArch Pharmacol. 1991 Sep;344(3):263-74. | |||||
REF 410 | trans-10,11-dihydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridine: a highly potent selective dopamine D1 full agonist. J Med Chem. 1990 Jun;33(6):1756-64. | |||||
REF 411 | Synthesis, structure-activity relationships, and biological properties of 1-heteroaryl-4-[omega-(1H-indol-3-yl)alkyl]piperazines, novel potential a... J Med Chem. 2005 Nov 3;48(22):6855-69. | |||||
REF 412 | Synthesis and SAR investigations for novel melanin-concentrating hormone 1 receptor (MCH1) antagonists part 2: A hybrid strategy combining key frag... J Med Chem. 2007 Aug 9;50(16):3883-90. | |||||
REF 413 | Dibenzazecine scaffold rebuilding--is the flexibility always essential for high dopamine receptor affinities Bioorg Med Chem. 2009 Oct 1;17(19):6898-907. | |||||
REF 414 | (Dipropylamino)-tetrahydronaphthofurans: centrally acting serotonin agonists and dopamine agonists-antagonists, Bioorg. Med. Chem. Lett. 7(21):2759-2764 (1997). | |||||
REF 415 | N-[2-[(substituted chroman-8-yl)oxy]ethyl]-4-(4-methoxyphenyl)butylamines: synthesis and wide range of antagonism at the human 5-HT1A receptor. J Med Chem. 1997 Apr 11;40(8):1252-7. | |||||
REF 416 | Discovery of beta-arrestin-biased dopamine D2 ligands for probing signal transduction pathways essential for antipsychotic efficacy. Proc Natl Acad Sci U S A. 2011 Nov 8;108(45):18488-93. | |||||
REF 417 | Novel 1-aminoethyl-3-arylsulfonyl-1H-pyrrolo[2,3-b]pyridines are potent 5-HT(6) agonists. Bioorg Med Chem. 2009 Jul 15;17(14):5153-63. | |||||
REF 418 | Nonconserved residues in the second transmembrane-spanning domain of the D(4) dopamine receptor are molecular determinants of D(4)-selective pharmacology. Mol Pharmacol. 2000 Jan;57(1):144-52. | |||||
REF 419 | Effect of N-alkylation on the affinities of analogues of spiperone for dopamine D2 and serotonin 5-HT2 receptors. J Med Chem. 1992 Feb 7;35(3):423-30. | |||||
REF 420 | Regulation of human D(1), d(2(long)), d(2(short)), D(3) and D(4) dopamine receptors by amiloride and amiloride analogues. Br J Pharmacol. 2000 Jul;130(5):1045-59. | |||||
REF 421 | Structure of a D2 dopamine receptor-G-protein complex in a lipid membrane. Nature. 2020 Aug;584(7819):125-129. | |||||
REF 422 | Structure of the D2 dopamine receptor bound to the atypical antipsychotic drug risperidone. Nature. 2018 Mar 8;555(7695):269-273. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.