Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T67162
(Former ID: TTDS00012)
|
|||||
Target Name |
Dopamine D2 receptor (D2R)
|
|||||
Synonyms |
Dopamine receptor 2; D(2) dopamine receptor
|
|||||
Gene Name |
DRD2
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 33 Target-related Diseases | + | ||||
1 | Allergic/hypersensitivity disorder [ICD-11: 4A80-4A8Z] | |||||
2 | Alzheimer disease [ICD-11: 8A20] | |||||
3 | Asthma [ICD-11: CA23] | |||||
4 | Attention deficit hyperactivity disorder [ICD-11: 6A05] | |||||
5 | Bipolar disorder [ICD-11: 6A60] | |||||
6 | Breathing abnormality [ICD-11: MD11] | |||||
7 | Cardiovascular disease [ICD-11: BA00-BE2Z] | |||||
8 | Cerebral ischaemia [ICD-11: 8B1Z] | |||||
9 | Depression [ICD-11: 6A70-6A7Z] | |||||
10 | Digestive system disease [ICD-11: DE2Z] | |||||
11 | Essential hypertension [ICD-11: BA00] | |||||
12 | Faecal incontinence [ICD-11: ME07] | |||||
13 | Gangrene [ICD-11: MC85] | |||||
14 | Glaucoma [ICD-11: 9C61] | |||||
15 | Heart failure [ICD-11: BD10-BD1Z] | |||||
16 | Hyperaemia [ICD-11: 9A61-9B7Y] | |||||
17 | Hypertension [ICD-11: BA00-BA04] | |||||
18 | Hypotension [ICD-11: BA20-BA21] | |||||
19 | Inborn porphyrin/heme metabolism error [ICD-11: 5C58] | |||||
20 | Insomnia [ICD-11: 7A00-7A0Z] | |||||
21 | Itching [ICD-11: 1F28-1G07] | |||||
22 | Migraine [ICD-11: 8A80] | |||||
23 | Nausea/vomiting [ICD-11: MD90] | |||||
24 | Pain [ICD-11: MG30-MG3Z] | |||||
25 | Parkinsonism [ICD-11: 8A00] | |||||
26 | Pituitary gland disorder [ICD-11: 5A60-5A61] | |||||
27 | Postpartum haemorrhage [ICD-11: JA43] | |||||
28 | Psychotic disorder [ICD-11: 6A20-6A25] | |||||
29 | Pulmonary hypertension [ICD-11: BB01] | |||||
30 | Schizophrenia [ICD-11: 6A20] | |||||
31 | Substance abuse [ICD-11: 6C40] | |||||
32 | Thyrotoxicosis [ICD-11: 5A02] | |||||
33 | Type 2 diabetes mellitus [ICD-11: 5A11] | |||||
Function |
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA VNPIIYTTFNIEFRKAFLKILHC Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
ADReCS ID | BADD_A03272 ; BADD_A04234 | |||||
HIT2.0 ID | T48ZIG |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 70 Approved Drugs | + | ||||
1 | Acetophenazine | Drug Info | Approved | Bipolar disorder | [2], [3] | |
2 | Amisulpride | Drug Info | Approved | Schizophrenia | [4], [5] | |
3 | Aniracetam | Drug Info | Approved | Cerebrovascular ischaemia | [6], [7] | |
4 | Apomorphine | Drug Info | Approved | Parkinson disease | [8], [9] | |
5 | Aripiprazole | Drug Info | Approved | Schizophrenia | [10], [11] | |
6 | Bevantolol | Drug Info | Approved | Hypertension | [3], [5] | |
7 | Bromocriptine | Drug Info | Approved | Parkinson disease | [12], [13] | |
8 | Cabergoline | Drug Info | Approved | Hyperprolactinaemia | [13], [14] | |
9 | Cariprazine | Drug Info | Approved | Bipolar disorder | [15], [16] | |
10 | Carphenazine | Drug Info | Approved | Insomnia | [3] | |
11 | Chlorpromazine | Drug Info | Approved | Schizophrenia | [17], [18] | |
12 | Chlorprothixene | Drug Info | Approved | Psychotic disorder | [19] | |
13 | Dapiprazole | Drug Info | Approved | Glaucoma/ocular hypertension | [3] | |
14 | Denopamine | Drug Info | Approved | Cardiac disease | [3], [20] | |
15 | Dihydroergotamine | Drug Info | Approved | Migraine | [21] | |
16 | Dihydroergotoxine | Drug Info | Approved | Alzheimer disease | [22] | |
17 | Docarpamine | Drug Info | Approved | Hypertension | [3] | |
18 | Domperidone | Drug Info | Approved | Gastrointestinal disease | [23], [24] | |
19 | Dopamine | Drug Info | Approved | Parkinson disease | [25], [26] | |
20 | Dopexamine | Drug Info | Approved | Cardiac failure | [3] | |
21 | Droperidol | Drug Info | Approved | Nausea | [27], [28] | |
22 | Ephedrine | Drug Info | Approved | Asthma | [29], [30] | |
23 | Ergonovine | Drug Info | Approved | Postpartum haemorrhage | [31], [32] | |
24 | Fluspirilene | Drug Info | Approved | Schizophrenia | [33], [34] | |
25 | Haloperidol | Drug Info | Approved | Schizophrenia | [5], [35] | |
26 | Ibopamine hci | Drug Info | Approved | Cardiac disease | [3] | |
27 | Iloperidone | Drug Info | Approved | Schizophrenia | [36], [37] | |
28 | Levodopa | Drug Info | Approved | Parkinson disease | [38] | |
29 | Levomepromazine | Drug Info | Approved | Psychotic disorder | [3] | |
30 | Lisuride | Drug Info | Approved | Parkinson disease | [39], [40] | |
31 | Loxapine | Drug Info | Approved | Schizophrenia | [3] | |
32 | lumateperone tosylate | Drug Info | Approved | Schizophrenia | [41] | |
33 | Lurasidone hydrochloride | Drug Info | Approved | Schizophrenia | [3], [42], [43], [44] | |
34 | Meglitinides | Drug Info | Approved | Type-2 diabetes | [45] | |
35 | Mephentermine | Drug Info | Approved | High blood pressure | [3] | |
36 | Mesoridazine | Drug Info | Approved | Schizophrenia | [46], [47] | |
37 | Metaraminol | Drug Info | Approved | Hypotension | [48], [49] | |
38 | Methamphetamine | Drug Info | Approved | Pain | [50] | |
39 | Methyldopa | Drug Info | Approved | Hypertension | [51], [52] | |
40 | Metoclopramide | Drug Info | Approved | Nausea | [53], [54] | |
41 | Molindone | Drug Info | Approved | Schizophrenia | [55], [56] | |
42 | N-0923 | Drug Info | Approved | Parkinson disease | [57], [58] | |
43 | Naphazoline | Drug Info | Approved | Itching | [3] | |
44 | Nemonapride | Drug Info | Approved | Schizophrenia | [59], [26] | |
45 | Olanzapine | Drug Info | Approved | Schizophrenia | [60], [61] | |
46 | OPC-34712 | Drug Info | Approved | Major depressive disorder | [62], [63] | |
47 | Perazine | Drug Info | Approved | Psychotic disorder | [3] | |
48 | Pergolide | Drug Info | Approved | Parkinson disease | [64], [13] | |
49 | Perphenazine | Drug Info | Approved | Schizophrenia | [65], [66] | |
50 | Phenoxybenzamine | Drug Info | Approved | Malignant essential hypertension | [3] | |
51 | Phentolamine | Drug Info | Approved | Dermal necrosis | [67], [68] | |
52 | Phenylephrine | Drug Info | Approved | Fecal incontinence | [69] | |
53 | Phenyltoloxamine | Drug Info | Approved | Allergy | [3] | |
54 | Pimozide | Drug Info | Approved | Schizophrenia | [70], [71] | |
55 | Piperacetazine | Drug Info | Approved | Schizophrenia | [3] | |
56 | Pramipexole | Drug Info | Approved | Parkinson disease | [72], [73] | |
57 | Prochlorperazine | Drug Info | Approved | Nausea | [74], [75] | |
58 | Pseudoephedrine | Drug Info | Approved | Nasal congestion | [76], [77] | |
59 | Quetiapine | Drug Info | Approved | Schizophrenia | [26], [78], [79] | |
60 | Quinagolide | Drug Info | Approved | Hyperprolactinaemia | [5] | |
61 | Risperidone | Drug Info | Approved | Schizophrenia | [80], [81] | |
62 | Ropinirole | Drug Info | Approved | Parkinson disease | [82], [83] | |
63 | Sulpiride | Drug Info | Approved | Schizophrenia | [84], [85] | |
64 | Thiethylperazine | Drug Info | Approved | Nausea | [86], [87] | |
65 | Thioridazine | Drug Info | Approved | Schizophrenia | [88], [89] | |
66 | Thiothixene | Drug Info | Approved | Schizophrenia | [90], [91] | |
67 | Tiapride | Drug Info | Approved | Alcohol dependence | [3] | |
68 | Tolazoline | Drug Info | Approved | Pulmonary hypertension | [92], [93], [3] | |
69 | Ziprasidone | Drug Info | Approved | Schizophrenia | [26], [94], [81] | |
70 | Zuclopenthixol | Drug Info | Approved | Schizophrenia | [95], [96] | |
Clinical Trial Drug(s) | [+] 43 Clinical Trial Drugs | + | ||||
1 | Bis(olanzapine) pamoate monohydrate | Drug Info | Phase 3 | Psychotic disorder | [3] | |
2 | Blonanserin | Drug Info | Phase 3 | Schizophrenia | [97], [26] | |
3 | CQA 206-291 | Drug Info | Phase 3 | Parkinson disease | [98] | |
4 | Entacapone+levodopa+carbidopa | Drug Info | Phase 3 | Restless legs syndrome | [99] | |
5 | Lu AF35700 | Drug Info | Phase 3 | Schizophrenia | [100] | |
6 | P2B-001 | Drug Info | Phase 3 | Parkinson disease | [101] | |
7 | Pridopidine | Drug Info | Phase 3 | Huntington disease | [102] | |
8 | RBP-7000 | Drug Info | Phase 3 | Non-small-cell lung cancer | [103] | |
9 | Sumanirole | Drug Info | Phase 3 | Parkinson disease | [104], [105] | |
10 | Zicronapine | Drug Info | Phase 3 | Schizophrenia | [106] | |
11 | Sarizotan | Drug Info | Phase 2/3 | Rett syndrome | [101] | |
12 | APD-403 | Drug Info | Phase 2 | Vomiting | [107] | |
13 | Aplindore fumarate | Drug Info | Phase 2 | Schizophrenia | [26] | |
14 | BIM23A760 | Drug Info | Phase 2 | Acromegaly | [108], [109] | |
15 | BL-1020 | Drug Info | Phase 2 | Schizophrenia | [26] | |
16 | CGS-15873A | Drug Info | Phase 2 | Psychotic disorder | [110] | |
17 | CLR-3001 | Drug Info | Phase 2 | Major depressive disorder | [111] | |
18 | JNJ-37822681 | Drug Info | Phase 2 | Schizophrenia | [112] | |
19 | Mazapertine succinate | Drug Info | Phase 2 | Psychotic disorder | [113] | |
20 | Ocaperidone | Drug Info | Phase 2 | Schizoaffective disorder | [114], [26], [115] | |
21 | ONC201 | Drug Info | Phase 2 | Glioma | [116], [101] | |
22 | Pardoprunox | Drug Info | Phase 2 | Parkinson disease | [73] | |
23 | PD-143188 | Drug Info | Phase 2 | Psychotic disorder | [117] | |
24 | ROXINDOLE | Drug Info | Phase 2 | Psychotic disorder | [118], [119] | |
25 | RP5063 | Drug Info | Phase 2 | Schizophrenia | [120] | |
26 | SDZ-MAR-327 | Drug Info | Phase 2 | Psychotic disorder | [26], [121] | |
27 | SEP--4199 | Drug Info | Phase 2 | Bipolar disorder | [122] | |
28 | TAK-906 | Drug Info | Phase 2 | Diabetic gastroparesis | [123] | |
29 | TBR-760 | Drug Info | Phase 2 | Pituitary adenoma | [124] | |
30 | XP-21279 | Drug Info | Phase 2 | Parkinson disease | [125] | |
31 | (-)-3PPP, Maryland | Drug Info | Phase 1 | Schizophrenia | [126] | |
32 | 1192U90 | Drug Info | Phase 1 | Psychotic disorder | [127] | |
33 | Abaperidone | Drug Info | Phase 1 | Schizophrenia | [128] | |
34 | ATI-9242 | Drug Info | Phase 1 | Schizophrenia | [100] | |
35 | Carmoxirole | Drug Info | Phase 1 | Hypertension | [129] | |
36 | DSP-1200 | Drug Info | Phase 1 | Depression | [100] | |
37 | Lu-02-750 | Drug Info | Phase 1 | Parkinson disease | [130] | |
38 | Lu-AE04621 | Drug Info | Phase 1 | Parkinson disease | [131] | |
39 | ONC206 | Drug Info | Phase 1 | Brain and central nervous system tumour | [132] | |
40 | SKL-10406 | Drug Info | Phase 1 | Major depressive disorder | [133] | |
41 | SSR-181507 | Drug Info | Phase 1 | Schizophrenia | [26] | |
42 | Umespirone | Drug Info | Phase 1 | Anxiety disorder | [134] | |
43 | YKP-1358 | Drug Info | Phase 1 | Schizoaffective disorder | [26] | |
Patented Agent(s) | [+] 3 Patented Agents | + | ||||
1 | PMID30124346-Compound-13TABLE4 | Drug Info | Patented | Attention deficit hyperactivity disorder | [135] | |
2 | PMID30124346-Compound-34TABLE4 | Drug Info | Patented | Attention deficit hyperactivity disorder | [135] | |
3 | PMID30124346-Compound-60TABLE5 | Drug Info | Patented | Parkinson disease | [136], [137], [135] | |
Discontinued Drug(s) | [+] 43 Discontinued Drugs | + | ||||
1 | Fencamfamine | Drug Info | Withdrawn from market | Depressive fatigue | [138] | |
2 | Flupenthixol | Drug Info | Withdrawn from market | Schizophrenia | [139], [140] | |
3 | Nomifensine | Drug Info | Withdrawn from market | Breast cancer | [141], [3] | |
4 | Remoxipride | Drug Info | Withdrawn from market | Schizophrenia | [142] | |
5 | Sertindole | Drug Info | Withdrawn from market | Schizophrenia | [143], [144] | |
6 | (S)-amisulpride | Drug Info | Discontinued in Phase 4 | Schizophrenia | [26] | |
7 | Bifeprunox | Drug Info | Discontinued in Phase 3 | Schizophrenia | [26] | |
8 | Lamectacin | Drug Info | Discontinued in Phase 3 | Bacterial infection | [145] | |
9 | NOLOMIROLE HYDROCHLORIDE | Drug Info | Discontinued in Phase 3 | Heart failure | [146] | |
10 | Sibenadet | Drug Info | Discontinued in Phase 3 | Chronic obstructive pulmonary disease | [147] | |
11 | BAM-1110 | Drug Info | Discontinued in Phase 2 | Parkinson disease | [148] | |
12 | Declopramide | Drug Info | Discontinued in Phase 2 | Inflammatory bowel disease | [149] | |
13 | FOSOPAMINE | Drug Info | Discontinued in Phase 2 | Hypertension | [150] | |
14 | Naxagolide | Drug Info | Discontinued in Phase 2 | Parkinson disease | [151] | |
15 | PF-217830 | Drug Info | Discontinued in Phase 2 | Schizophrenia | [152] | |
16 | Romergoline | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [153] | |
17 | SAVOXEPIN MESYLATE | Drug Info | Discontinued in Phase 2 | Psychotic disorder | [154] | |
18 | SLV-310 | Drug Info | Discontinued in Phase 2 | Schizophrenia | [26] | |
19 | AM-831 | Drug Info | Discontinued in Phase 1 | Schizophrenia | [155] | |
20 | DU-29894 | Drug Info | Discontinued in Phase 1 | Psychotic disorder | [156] | |
21 | Ordopidine | Drug Info | Discontinued in Phase 1 | Psychotic disorder | [157] | |
22 | S-18327 | Drug Info | Discontinued in Phase 1 | Psychotic disorder | [158] | |
23 | SDZ-GLC-756 | Drug Info | Discontinued in Phase 1 | Glaucoma/ocular hypertension | [159] | |
24 | SLV-313 | Drug Info | Discontinued in Phase 1 | Schizophrenia | [26] | |
25 | A-68930 | Drug Info | Terminated | Hypertension | [163], [164] | |
26 | AMR-103 | Drug Info | Terminated | Parkinson disease | [165] | |
27 | BIMG80 | Drug Info | Terminated | Psychotic disorder | [166] | |
28 | CGP-25454A | Drug Info | Terminated | Major depressive disorder | [167] | |
29 | CP-903397 | Drug Info | Terminated | Schizophrenia | [168] | |
30 | Dianicline+rimonabant | Drug Info | Terminated | Tobacco dependence | [169] | |
31 | E-2040 | Drug Info | Terminated | Schizophrenia | [170] | |
32 | Etrabamine | Drug Info | Terminated | Parkinson disease | [171] | |
33 | GMC-283 | Drug Info | Terminated | Schizophrenia | [26] | |
34 | LY-243062 | Drug Info | Terminated | Inflammation | [172] | |
35 | NGD-93-1 | Drug Info | Terminated | Psychotic disorder | [173] | |
36 | NNC-22-0031 | Drug Info | Terminated | Psychotic disorder | [174] | |
37 | Org-10490 | Drug Info | Terminated | Psychotic disorder | [175] | |
38 | PNU-96391A | Drug Info | Terminated | Substance use disorder | [176] | |
39 | RWJ-25730 | Drug Info | Terminated | Psychotic disorder | [177] | |
40 | SLV-307 | Drug Info | Terminated | Parkinson disease | [178] | |
41 | Y-20024 | Drug Info | Terminated | Psychotic disorder | [179] | |
42 | Y-931 | Drug Info | Terminated | Schizophrenia | [26] | |
43 | ZD-3638 | Drug Info | Terminated | Schizophrenia | [26] | |
Preclinical Drug(s) | [+] 6 Preclinical Drugs | + | ||||
1 | F-15063 | Drug Info | Preclinical | Schizophrenia | [160] | |
2 | Org-23366 | Drug Info | Preclinical | Schizophrenia | [26] | |
3 | PD-157695 | Drug Info | Preclinical | Schizophrenia | [26] | |
4 | PD-158771 | Drug Info | Preclinical | Schizophrenia | [26] | |
5 | PGX-200097 | Drug Info | Preclinical | Schizophrenia | [161] | |
6 | S32504 | Drug Info | Preclinical | Parkinson disease | [162] | |
Mode of Action | [+] 8 Modes of Action | + | ||||
Antagonist | [+] 59 Antagonist drugs | + | ||||
1 | Acetophenazine | Drug Info | [180], [181] | |||
2 | Amisulpride | Drug Info | [180], [182], [183] | |||
3 | Bevantolol | Drug Info | [187], [188] | |||
4 | Carphenazine | Drug Info | [180], [193] | |||
5 | Chlorpromazine | Drug Info | [194], [195], [196] | |||
6 | Chlorprothixene | Drug Info | [197] | |||
7 | Dapiprazole | Drug Info | [198] | |||
8 | Domperidone | Drug Info | [200], [201] | |||
9 | Fluspirilene | Drug Info | [206] | |||
10 | Haloperidol | Drug Info | [207], [180] | |||
11 | Iloperidone | Drug Info | [37], [26] | |||
12 | Loxapine | Drug Info | [213] | |||
13 | lumateperone tosylate | Drug Info | [41] | |||
14 | Meglitinides | Drug Info | [214], [215] | |||
15 | Metoclopramide | Drug Info | [220], [201] | |||
16 | Perphenazine | Drug Info | [227], [228] | |||
17 | Phenoxybenzamine | Drug Info | [229] | |||
18 | Phentolamine | Drug Info | [230] | |||
19 | Pimozide | Drug Info | [234], [180] | |||
20 | Prochlorperazine | Drug Info | [235], [236] | |||
21 | Risperidone | Drug Info | [241], [242] | |||
22 | Sulpiride | Drug Info | [215], [243], [244] | |||
23 | Thiethylperazine | Drug Info | [245], [246] | |||
24 | Thioridazine | Drug Info | [247], [248] | |||
25 | Thiothixene | Drug Info | [249] | |||
26 | Tiapride | Drug Info | [243] | |||
27 | Tolazoline | Drug Info | [250] | |||
28 | Zuclopenthixol | Drug Info | [252], [180] | |||
29 | Blonanserin | Drug Info | [26] | |||
30 | APD-403 | Drug Info | [262] | |||
31 | BL-1020 | Drug Info | [26] | |||
32 | ONC201 | Drug Info | [116] | |||
33 | RP5063 | Drug Info | [269], [270] | |||
34 | SEP--4199 | Drug Info | [122] | |||
35 | 1192U90 | Drug Info | [26] | |||
36 | DSP-1200 | Drug Info | [100] | |||
37 | ONC206 | Drug Info | [280] | |||
38 | Umespirone | Drug Info | [283] | |||
39 | L-piperazino-3-phenyl-indane derivative 1 | Drug Info | [286] | |||
40 | Flupenthixol | Drug Info | [288], [180] | |||
41 | Nomifensine | Drug Info | [289], [290] | |||
42 | Remoxipride | Drug Info | [180], [213] | |||
43 | Sertindole | Drug Info | [291], [292] | |||
44 | (S)-amisulpride | Drug Info | [26] | |||
45 | Lamectacin | Drug Info | [294], [79] | |||
46 | Org-23366 | Drug Info | [26] | |||
47 | PD-157695 | Drug Info | [26] | |||
48 | PD-158771 | Drug Info | [26] | |||
49 | Dianicline+rimonabant | Drug Info | [320] | |||
50 | GMC-283 | Drug Info | [26] | |||
51 | SLV-307 | Drug Info | [327] | |||
52 | (+)-S-14297 | Drug Info | [331] | |||
53 | Anti-D | Drug Info | [368] | |||
54 | CLR-151 | Drug Info | [262] | |||
55 | ML321 | Drug Info | [388] | |||
56 | nafadotride | Drug Info | [393] | |||
57 | S-(-)-sulpiride | Drug Info | [215], [243], [244] | |||
58 | [3H]N-methylspiperone | Drug Info | [414], [415] | |||
59 | [3H]spiperone | Drug Info | [416], [330] | |||
Inhibitor | [+] 202 Inhibitor drugs | + | ||||
1 | Aniracetam | Drug Info | [184] | |||
2 | Phenyltoloxamine | Drug Info | [233] | |||
3 | P2B-001 | Drug Info | [256] | |||
4 | ROXINDOLE | Drug Info | [268] | |||
5 | TAK-906 | Drug Info | [272] | |||
6 | TIOSPIRONE | Drug Info | [297] | |||
7 | MAZAPERTINE | Drug Info | [301] | |||
8 | PGX-200097 | Drug Info | [313] | |||
9 | A-68930 | Drug Info | [314] | |||
10 | A-80426 | Drug Info | [315] | |||
11 | PD-128483 | Drug Info | [325] | |||
12 | (+)-(1R,1'S)-berbamunine hydrochloride | Drug Info | [329] | |||
13 | (+)-(1R,1'S)-thaligrisine hydrochloride | Drug Info | [329] | |||
14 | (+)-BUTACLAMOL | Drug Info | [330] | |||
15 | (+/-)-nantenine | Drug Info | [332] | |||
16 | (-)-(1S,1'R)-O,O-dimethylgrisbine hydrochloride | Drug Info | [329] | |||
17 | (-)-3-(1-Propyl-piperidin-3-yl)-benzonitrile | Drug Info | [333] | |||
18 | (4-Ethynyl-cyclohex-3-enyl)-dipropyl-amine | Drug Info | [334] | |||
19 | (4-Quinolin-2-ylpiperazin-1-yl)acetic Acid | Drug Info | [335] | |||
20 | (5-Methoxy-chroman-3-yl)-dipropyl-amine | Drug Info | [336] | |||
21 | (R)-(+)-coclaurine | Drug Info | [337] | |||
22 | (R)-(-)-10-methyl-11-hydroxyaporphine | Drug Info | [338] | |||
23 | (R)-(-)-11-hydroxy-N-n-propylnoraporphine | Drug Info | [339] | |||
24 | (R)-(-)-2-methoxy-11-hydroxyaporphine | Drug Info | [339] | |||
25 | (R)-(-)-2-methoxy-N-npropylnorapomorphine | Drug Info | [339] | |||
26 | (R)-(-)-2-Methyl-apomorphine hydrochloride | Drug Info | [340] | |||
27 | (R)-(-)-2-Phenyl-apomorphine hydrochloride | Drug Info | [340] | |||
28 | (R)-(-)-N-ethyl-2-methoxy-11-hydroxynoraporphine | Drug Info | [339] | |||
29 | (R)-(-)-N-propyl-2-methoxy-11-hydroxynoraporphine | Drug Info | [339] | |||
30 | (S)-BULBOCAPNINE | Drug Info | [341] | |||
31 | (S)-secoantioquine hydrochloride | Drug Info | [329] | |||
32 | (S)APOMORPHINE | Drug Info | [342] | |||
33 | (S,R)-antioquine hydrochloride | Drug Info | [329] | |||
34 | (S,R)-isotetrandrine hydrochloride | Drug Info | [329] | |||
35 | (S,R)-pseudoxandrine hydrochloride | Drug Info | [329] | |||
36 | (S,S)-oxandrine hydrochloride | Drug Info | [329] | |||
37 | 1,2,3,7,12,12a-hexahydro-1-aza-pleiadene-5,6-diol | Drug Info | [341] | |||
38 | 1,2-Bis-[R-(-)-apomorphine-2'-oxy]ethane | Drug Info | [343] | |||
39 | 1,6-bis(4-(3-chlorophenyl)piperazin-1-yl)hexane | Drug Info | [344] | |||
40 | 1,6-bis(4-(3-methoxyphenyl)piperazin-1-yl)hexane | Drug Info | [344] | |||
41 | 1,6-bis(4-(pyridin-2-yl)piperazin-1-yl)hexane | Drug Info | [344] | |||
42 | 1,6-bis(4-m-tolylpiperazin-1-yl)hexane | Drug Info | [344] | |||
43 | 1,6-bis(4-phenylpiperazin-1-yl)hexane | Drug Info | [344] | |||
44 | 1-(3-Hydroxyphenyl)-4-propylpiperazine | Drug Info | [258] | |||
45 | 1-(4-(1H-pyrazol-1-yl)benzyl)-4-phenylpiperazine | Drug Info | [345] | |||
46 | 1-(4-(4-phenyl-1-piperazinyl)butyl)indolin-2-one | Drug Info | [346] | |||
47 | 1-(benzyloxy)-2-(2-phenylethyl)benzene | Drug Info | [347] | |||
48 | 1-(benzyloxy)-2-[2-(3-methoxyphenyl)ethyl]benzene | Drug Info | [347] | |||
49 | 1-Aminomethyl-3-cyclohexyl-isochroman-5,6-diol | Drug Info | [348] | |||
50 | 1-Aminomethyl-isochroman-5,6-diol | Drug Info | [314] | |||
51 | 1-Benzyl-4-(2-ethynyl-pyrrol-1-yl)-piperidine | Drug Info | [349] | |||
52 | 1-Benzyl-4-(2-iodo-pyrrol-1-yl)-piperidine | Drug Info | [349] | |||
53 | 1-Benzyl-4-(2-oxazol-5-yl-pyrrol-1-yl)-piperidine | Drug Info | [349] | |||
54 | 1-Benzyl-4-(3-hydroxyphenyl)piperidine | Drug Info | [258] | |||
55 | 1-Benzyl-4-(3-oxazol-5-yl-pyrrol-1-yl)-piperidine | Drug Info | [349] | |||
56 | 1-Benzyl-4-pyrrol-1-yl-piperidine | Drug Info | [349] | |||
57 | 1-Benzyl-4-[3-(methylsulfonyl)phenyl]piperazine | Drug Info | [258] | |||
58 | 1-Benzyl-4-[3-(methylsulfonyl)phenyl]piperidine | Drug Info | [258] | |||
59 | 1-Dibenzo[b,f]oxepin-10-yl-4-methyl-piperazine | Drug Info | [350] | |||
60 | 1-Methyl-1,2,3,4-tetrahydro-isoquinoline-6,7-diol | Drug Info | [351] | |||
61 | 1-Propyl-3-(3-trifluoromethyl-phenyl)-pyrrolidine | Drug Info | [352] | |||
62 | 1-Propyl-3-m-tolyl-piperidine hydrochloride | Drug Info | [353] | |||
63 | 1-Propyl-3-o-tolyl-piperidine hydrochloride | Drug Info | [353] | |||
64 | 1-Propyl-3-p-tolyl-piperidine hydrochloride | Drug Info | [353] | |||
65 | 1-[(3-methoxybenzyl)oxy]-2-(2-phenylethyl)benzene | Drug Info | [347] | |||
66 | 1-[2-(2-Benzyl-phenoxy)-ethyl]-piperidine | Drug Info | [233] | |||
67 | 1-[3-(2-Benzyl-phenoxy)-propyl]-pyrrolidine | Drug Info | [233] | |||
68 | 1-[3-(Methylsulfonyl)phenyl]-4-propylpiperazine | Drug Info | [258] | |||
69 | 2,3-Dihydro-1H-indol-5-ol | Drug Info | [351] | |||
70 | 2-(4-Dipropylamino-cyclohexylidene)-malononitrile | Drug Info | [334] | |||
71 | 2-methoxyapomorphine | Drug Info | [343] | |||
72 | 2-Methyl-8-phenyl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [354] | |||
73 | 2-{[2-(2-phenylethyl)phenoxy]methyl}pyridine | Drug Info | [347] | |||
74 | 2-{[R-(-)-Apomorphine-2'-oxy]ethoxy}-ethanol | Drug Info | [343] | |||
75 | 3,8-dibromoboldine | Drug Info | [355] | |||
76 | 3-(1-Propyl-pyrrolidin-3-yl)-phenol | Drug Info | [352] | |||
77 | 3-(2,3-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [356] | |||
78 | 3-(2,3-Dimethyl-phenyl)-piperidine | Drug Info | [356] | |||
79 | 3-(2,4-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [356] | |||
80 | 3-(2,5-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [356] | |||
81 | 3-(2,6-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [356] | |||
82 | 3-(2-Benzylamino-ethoxy)-phenol | Drug Info | [357] | |||
83 | 3-(3,4-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [356] | |||
84 | 3-(3,4-Dimethyl-phenyl)-piperidine | Drug Info | [356] | |||
85 | 3-(3,5-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [356] | |||
86 | 3-(3,5-Dimethyl-phenyl)-piperidine | Drug Info | [356] | |||
87 | 3-(4-Benzyl-piperazin-1-yl)-phenol | Drug Info | [358] | |||
88 | 3-(4-Benzyl-piperidin-1-ylmethyl)-chroman-4-one | Drug Info | [330] | |||
89 | 3-(4-Methyl-piperidin-1-ylmethyl)-1H-indole | Drug Info | [359] | |||
90 | 3-(4-Phenyl-piperazin-1-ylmethyl)-1H-indole | Drug Info | [359] | |||
91 | 3-(4-Phenyl-piperidin-1-ylmethyl)-1H-indole | Drug Info | [359] | |||
92 | 3-(N-propylpiperidin-4-yl)phenol | Drug Info | [258] | |||
93 | 3-(Octahydro-indolizin-8-yl)-phenol | Drug Info | [360] | |||
94 | 3-(Octahydro-quinolizin-1-yl)-phenol | Drug Info | [360] | |||
95 | 3-(Octahydro-quinolizin-3-yl)-phenol | Drug Info | [360] | |||
96 | 3-bromoboldine | Drug Info | [355] | |||
97 | 3-Butyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol | Drug Info | [361] | |||
98 | 3-Chloroboldine | Drug Info | [355] | |||
99 | 3-Cyclohexyl-1-propyl-piperidine hydrochloride | Drug Info | [353] | |||
100 | 3-Ethyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol | Drug Info | [361] | |||
101 | 3-Iodoboldine | Drug Info | [355] | |||
102 | 3-Naphthalen-1-yl-1-propyl-pyrrolidine | Drug Info | [352] | |||
103 | 3-Naphthalen-1-yl-pyrrolidine | Drug Info | [352] | |||
104 | 3-Phenyl-1-propyl-piperidine hydrochloride | Drug Info | [353] | |||
105 | 3-Phenyl-1-propyl-pyrrolidine | Drug Info | [352] | |||
106 | 3-Phenyl-pyrrolidine | Drug Info | [352] | |||
107 | 3-{[2-(2-phenylethyl)phenoxy]methyl}pyridine | Drug Info | [347] | |||
108 | 4-(2-Benzylamino-ethoxy)-1,3-dihydro-indol-2-one | Drug Info | [357] | |||
109 | 4-(4-Benzyl-piperazin-1-yl)-1H-benzoimidazole | Drug Info | [358] | |||
110 | 4-(4-Benzyl-piperazin-1-yl)-1H-indole | Drug Info | [358] | |||
111 | 4-(4-Benzyl-piperazin-1-yl)-5-chloro-1H-indole | Drug Info | [358] | |||
112 | 4-(4-Benzyl-piperazin-1-yl)-7-bromo-1H-indole | Drug Info | [358] | |||
113 | 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [362] | |||
114 | 4-Benzyl-1-chroman-2-ylmethyl-piperidine | Drug Info | [330] | |||
115 | 4-Benzyl-1-chroman-3-ylmethyl-piperidine | Drug Info | [330] | |||
116 | 4-Benzyl-1-indan-2-ylmethyl-piperidine | Drug Info | [330] | |||
117 | 5-OH-DPAT | Drug Info | [363] | |||
118 | 7-(2-Amino-ethyl)-4-hydroxy-3H-benzothiazol-2-one | Drug Info | [364] | |||
119 | 7-(2-Dipropylamino-ethyl)-3H-benzothiazol-2-one | Drug Info | [364] | |||
120 | A-690344 | Drug Info | [366] | |||
121 | A-706149 | Drug Info | [367] | |||
122 | ANOLOBINE | Drug Info | [341] | |||
123 | ANONAINE | Drug Info | [341] | |||
124 | Azaperone | Drug Info | [369] | |||
125 | Benzyl-[2-(1H-indazol-4-yloxy)-ethyl]-amine | Drug Info | [357] | |||
126 | Benzyl-[2-(1H-indol-4-yloxy)-ethyl]-amine | Drug Info | [357] | |||
127 | Bis-{[R-(-)-apomorphine-2-oxy]ethyl} ether | Drug Info | [343] | |||
128 | BOLDINE | Drug Info | [355] | |||
129 | BRL-25594 | Drug Info | [370] | |||
130 | BRL-26175 | Drug Info | [371] | |||
131 | CLEBOPRIDE | Drug Info | [370] | |||
132 | D-189 | Drug Info | [372] | |||
133 | D-190 | Drug Info | [372] | |||
134 | D-192 | Drug Info | [372] | |||
135 | D-193 | Drug Info | [372] | |||
136 | D-203 | Drug Info | [372] | |||
137 | D-210 | Drug Info | [372] | |||
138 | D-218 | Drug Info | [372] | |||
139 | D-219 | Drug Info | [372] | |||
140 | D-220 | Drug Info | [372] | |||
141 | D-237 | Drug Info | [373] | |||
142 | D-264 | Drug Info | [374] | |||
143 | D-315 | Drug Info | [375] | |||
144 | D-366 | Drug Info | [363] | |||
145 | EPIDEPRIDE | Drug Info | [376] | |||
146 | Ethyl-(4,5,6,7-tetrahydro-2H-indazol-5-yl)-amine | Drug Info | [377] | |||
147 | ETICLOPRIDE | Drug Info | [378] | |||
148 | Etoloxamine | Drug Info | [233] | |||
149 | FLUANISONE | Drug Info | [379] | |||
150 | FLUMEZAPINE | Drug Info | [380] | |||
151 | FLUTROLINE | Drug Info | [381] | |||
152 | GLAUCINE | Drug Info | [341] | |||
153 | IBZM | Drug Info | [376] | |||
154 | IODOPRIDE | Drug Info | [376] | |||
155 | IODOSULPIRIDE | Drug Info | [376] | |||
156 | ISOCLOZAPINE | Drug Info | [382] | |||
157 | ISOLOXAPINE | Drug Info | [383] | |||
158 | L-741626 | Drug Info | [384] | |||
159 | MCL-515 | Drug Info | [387] | |||
160 | MCL-516 | Drug Info | [387] | |||
161 | N-(4-Dipropylaminobutyl)-4-biphenylcarboxamide | Drug Info | [390] | |||
162 | N-Benzyl-4-(2-diphenyl)-1-piperazinehexanamide | Drug Info | [386] | |||
163 | N-Ethyl-2-methylnorapomorphine hydrochloride | Drug Info | [391] | |||
164 | N-Ethyl-2-phenylnorapomorphine hydrochloride | Drug Info | [391] | |||
165 | N-Propyl-2-methylnorapomorphine hydrochloride | Drug Info | [391] | |||
166 | N-Propyl-2-phenylnorapomorphine hydrochloride | Drug Info | [391] | |||
167 | N-propylnorapomorphine | Drug Info | [392], [339] | |||
168 | NOR-ROEFRACTINE | Drug Info | [337] | |||
169 | OCTOCLOTHEPIN | Drug Info | [394] | |||
170 | PD-135111 | Drug Info | [325] | |||
171 | PD-135146 | Drug Info | [325] | |||
172 | PD-135188 | Drug Info | [325] | |||
173 | PD-135222 | Drug Info | [325] | |||
174 | PD-135385 | Drug Info | [325] | |||
175 | PD-135478 | Drug Info | [325] | |||
176 | PD-135540 | Drug Info | [325] | |||
177 | PD-137789 | Drug Info | [325] | |||
178 | PD-137821 | Drug Info | [325] | |||
179 | PD-168077 | Drug Info | [353] | |||
180 | PD-172938 | Drug Info | [396] | |||
181 | PD-172939 | Drug Info | [396] | |||
182 | PG-01037 | Drug Info | [397] | |||
183 | Preclamol | Drug Info | [360] | |||
184 | Propyl-(4,5,6,7-tetrahydro-2H-indazol-5-yl)-amine | Drug Info | [377] | |||
185 | PUKATEINE | Drug Info | [341] | |||
186 | QUINPIROLE | Drug Info | [356] | |||
187 | Ro-21-7767 | Drug Info | [399] | |||
188 | Rolicyclidine | Drug Info | [400] | |||
189 | SB-258719 | Drug Info | [401] | |||
190 | SB-271046 | Drug Info | [402] | |||
191 | SCH-24518 | Drug Info | [404] | |||
192 | SK&F-89626 | Drug Info | [406] | |||
193 | SKF-89124A | Drug Info | [364] | |||
194 | SLV-314 | Drug Info | [407] | |||
195 | SNAP-94847 | Drug Info | [408] | |||
196 | STEPHOLIDINE | Drug Info | [409] | |||
197 | UH-232 | Drug Info | [410] | |||
198 | UH-301 | Drug Info | [411] | |||
199 | WAY-208466 | Drug Info | [413] | |||
200 | [2-(1H-Benzoimidazol-4-yloxy)-ethyl]-benzyl-amine | Drug Info | [357] | |||
201 | [3H]7-OH-DPAT | Drug Info | [373] | |||
202 | [R-(-)-Apomorphine-2-yl]-(2'-hydroxy-ethyl)ether | Drug Info | [343] | |||
Agonist | [+] 55 Agonist drugs | + | ||||
1 | Apomorphine | Drug Info | [185] | |||
2 | Aripiprazole | Drug Info | [186] | |||
3 | Bromocriptine | Drug Info | [1], [189], [190] | |||
4 | Cabergoline | Drug Info | [191], [192] | |||
5 | Dihydroergotamine | Drug Info | [199] | |||
6 | Dihydroergotoxine | Drug Info | [22] | |||
7 | Dopamine | Drug Info | [202], [203] | |||
8 | Ephedrine | Drug Info | [30] | |||
9 | Ergonovine | Drug Info | [205] | |||
10 | Lisuride | Drug Info | [210], [211], [212] | |||
11 | Mephentermine | Drug Info | [216] | |||
12 | Mesoridazine | Drug Info | [217] | |||
13 | Metaraminol | Drug Info | [218] | |||
14 | Methamphetamine | Drug Info | [50] | |||
15 | Methyldopa | Drug Info | [219] | |||
16 | N-0923 | Drug Info | [105] | |||
17 | Naphazoline | Drug Info | [223] | |||
18 | Nemonapride | Drug Info | [26] | |||
19 | Olanzapine | Drug Info | [61] | |||
20 | Phenylephrine | Drug Info | [231], [232] | |||
21 | Quetiapine | Drug Info | [26], [180], [239] | |||
22 | Quinagolide | Drug Info | [240] | |||
23 | Ziprasidone | Drug Info | [251] | |||
24 | Talipexole | Drug Info | [253] | |||
25 | CQA 206-291 | Drug Info | [254] | |||
26 | Entacapone+levodopa+carbidopa | Drug Info | [255] | |||
27 | Sumanirole | Drug Info | [105] | |||
28 | Aplindore fumarate | Drug Info | [26], [263] | |||
29 | JNJ-37822681 | Drug Info | [266] | |||
30 | Pardoprunox | Drug Info | [73] | |||
31 | TBR-760 | Drug Info | [273] | |||
32 | XP-21279 | Drug Info | [274] | |||
33 | (-)-3PPP, Maryland | Drug Info | [26] | |||
34 | Carmoxirole | Drug Info | [277] | |||
35 | Lu-02-750 | Drug Info | [278] | |||
36 | Fencamfamine | Drug Info | [287] | |||
37 | NOLOMIROLE HYDROCHLORIDE | Drug Info | [295], [3] | |||
38 | SAVOXEPIN MESYLATE | Drug Info | [304], [3] | |||
39 | AM-831 | Drug Info | [306] | |||
40 | AMR-103 | Drug Info | [316] | |||
41 | Y-20024 | Drug Info | [328], [3] | |||
42 | 7-trans-OH-PIPAT | Drug Info | [365] | |||
43 | LP-12 | Drug Info | [385] | |||
44 | LP-211 | Drug Info | [386] | |||
45 | LP-44 | Drug Info | [385] | |||
46 | MLS1547 | Drug Info | [389] | |||
47 | PD 128907 | Drug Info | [395] | |||
48 | PF-03800130 | Drug Info | [262] | |||
49 | piribedil | Drug Info | [398] | |||
50 | Rotigitine | Drug Info | [13] | |||
51 | Uinagolide | Drug Info | [240] | |||
52 | UNC0006 | Drug Info | [412] | |||
53 | UNC9975 | Drug Info | [412] | |||
54 | UNC9994 | Drug Info | [412] | |||
55 | WS-50030 | Drug Info | [262] | |||
Modulator | [+] 61 Modulator drugs | + | ||||
1 | Cariprazine | Drug Info | [16] | |||
2 | Denopamine | Drug Info | [5] | |||
3 | Docarpamine | Drug Info | [5] | |||
4 | Dopexamine | Drug Info | [5] | |||
5 | Ibopamine hci | Drug Info | [5], [208] | |||
6 | Levodopa | Drug Info | [38] | |||
7 | Levomepromazine | Drug Info | [209] | |||
8 | Lurasidone hydrochloride | Drug Info | [43], [44] | |||
9 | OPC-34712 | Drug Info | [224], [225] | |||
10 | Perazine | Drug Info | [226], [3] | |||
11 | Pergolide | Drug Info | [209] | |||
12 | Piperacetazine | Drug Info | [209] | |||
13 | Pramipexole | Drug Info | [209] | |||
14 | Ropinirole | Drug Info | [209] | |||
15 | Bis(olanzapine) pamoate monohydrate | Drug Info | [3] | |||
16 | Lu AF35700 | Drug Info | [100] | |||
17 | Pridopidine | Drug Info | [257], [258] | |||
18 | RBP-7000 | Drug Info | [259] | |||
19 | Zicronapine | Drug Info | [260] | |||
20 | Sarizotan | Drug Info | [261] | |||
21 | BIM23A760 | Drug Info | [108] | |||
22 | CGS-15873A | Drug Info | [264], [3] | |||
23 | CLR-3001 | Drug Info | [265] | |||
24 | Mazapertine succinate | Drug Info | [261] | |||
25 | Ocaperidone | Drug Info | [115] | |||
26 | PD-143188 | Drug Info | [267] | |||
27 | SDZ-MAR-327 | Drug Info | [271] | |||
28 | Abaperidone | Drug Info | [275] | |||
29 | ATI-9242 | Drug Info | [276] | |||
30 | Lu-AE04621 | Drug Info | [279] | |||
31 | SSR-181507 | Drug Info | [282] | |||
32 | YKP-1358 | Drug Info | [284] | |||
33 | Bifeprunox | Drug Info | [293] | |||
34 | Sibenadet | Drug Info | [296] | |||
35 | BAM-1110 | Drug Info | [298] | |||
36 | Declopramide | Drug Info | [299] | |||
37 | FOSOPAMINE | Drug Info | [300], [3] | |||
38 | Naxagolide | Drug Info | [302] | |||
39 | PF-217830 | Drug Info | [261] | |||
40 | Romergoline | Drug Info | [303] | |||
41 | SLV-310 | Drug Info | [305] | |||
42 | DU-29894 | Drug Info | [307] | |||
43 | Ordopidine | Drug Info | [308] | |||
44 | S-18327 | Drug Info | [309] | |||
45 | SDZ-GLC-756 | Drug Info | [310] | |||
46 | SLV-313 | Drug Info | [311] | |||
47 | F-15063 | Drug Info | [312] | |||
48 | S32504 | Drug Info | [162] | |||
49 | BIMG80 | Drug Info | [317] | |||
50 | CGP-25454A | Drug Info | [318] | |||
51 | CP-903397 | Drug Info | [319] | |||
52 | E-2040 | Drug Info | [321] | |||
53 | Etrabamine | Drug Info | [322] | |||
54 | LY-243062 | Drug Info | [323] | |||
55 | NGD-93-1 | Drug Info | [324] | |||
56 | NNC-22-0031 | Drug Info | [174] | |||
57 | Org-10490 | Drug Info | [209] | |||
58 | PNU-96391A | Drug Info | [176] | |||
59 | RWJ-25730 | Drug Info | [326] | |||
60 | SDZ-208911 | Drug Info | [405], [3] | |||
61 | SEL-73 | Drug Info | [262] | |||
Binder | [+] 5 Binder drugs | + | ||||
1 | Droperidol | Drug Info | [204] | |||
2 | Molindone | Drug Info | [221], [222] | |||
3 | SKL-10406 | Drug Info | [281] | |||
4 | Y-931 | Drug Info | [26] | |||
5 | ZD-3638 | Drug Info | [26] | |||
Stimulator | [+] 1 Stimulator drugs | + | ||||
1 | Pseudoephedrine | Drug Info | [237], [238] | |||
Ligand | [+] 11 Ligand drugs | + | ||||
1 | Aryl piperazine derivative 1 | Drug Info | [135] | |||
2 | Aryl piperazine derivative 6 | Drug Info | [135] | |||
3 | Benzo[d]oxazol-2(3H)-one derivative 1 | Drug Info | [285] | |||
4 | Benzo[d]oxazol-2(3H)-one derivative 2 | Drug Info | [285] | |||
5 | Benzo[d]oxazol-2(3H)-one derivative 3 | Drug Info | [285] | |||
6 | PMID29334795-Compound-62 | Drug Info | [285] | |||
7 | PMID29334795-Compound-66 | Drug Info | [285] | |||
8 | PMID29334795-Compound-67 | Drug Info | [285] | |||
9 | PMID30124346-Compound-13TABLE4 | Drug Info | [135] | |||
10 | PMID30124346-Compound-34TABLE4 | Drug Info | [135] | |||
11 | PMID30124346-Compound-60TABLE5 | Drug Info | [135] | |||
Modulator (allosteric modulator) | [+] 1 Modulator (allosteric modulator) drugs | + | ||||
1 | SB269652 | Drug Info | [403] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 8 KEGG Pathways | + | ||||
1 | Rap1 signaling pathway | |||||
2 | cAMP signaling pathway | |||||
3 | Neuroactive ligand-receptor interaction | |||||
4 | Gap junction | |||||
5 | Dopaminergic synapse | |||||
6 | Parkinson's disease | |||||
7 | Cocaine addiction | |||||
8 | Alcoholism | |||||
Panther Pathway | [+] 4 Panther Pathways | + | ||||
1 | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
2 | Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
3 | Dopamine receptor mediated signaling pathway | |||||
4 | Nicotine pharmacodynamics pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Dopamine receptors | |||||
2 | G alpha (i) signalling events | |||||
WikiPathways | [+] 7 WikiPathways | + | ||||
1 | Hypothetical Network for Drug Addiction | |||||
2 | Monoamine GPCRs | |||||
3 | GPCRs, Class A Rhodopsin-like | |||||
4 | Genes and (Common) Pathways Underlying Drug Addiction | |||||
5 | GPCR ligand binding | |||||
6 | GPCR downstream signaling | |||||
7 | Nicotine Activity on Dopaminergic Neurons |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Silymarin BIO-C, an extract from Silybum marianum fruits, induces hyperprolactinemia in intact female rats. Phytomedicine. 2009 Sep;16(9):839-44. | |||||
REF 2 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 012254. | |||||
REF 3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 963). | |||||
REF 5 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | |||||
REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4133). | |||||
REF 7 | Anxiolytic effects of aniracetam in three different mouse models of anxiety and the underlying mechanism. Eur J Pharmacol. 2001 May 18;420(1):33-43. | |||||
REF 8 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 33). | |||||
REF 9 | ClinicalTrials.gov (NCT02339064) Infusion of Apomorphine: Long-term Safety Study. U.S. National Institutes of Health. | |||||
REF 10 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 34). | |||||
REF 11 | Electrophysiological studies in the rat brain on the basis for aripiprazole augmentation of antidepressants in major depressive disorder. Psychopharmacology (Berl). 2009 Oct;206(2):335-44. | |||||
REF 12 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 35). | |||||
REF 13 | Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54. | |||||
REF 14 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 37). | |||||
REF 15 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7671). | |||||
REF 16 | Radium 223 dichloride for prostate cancer treatment. Drug Des Devel Ther. 2017 Sep 6;11:2643-2651. | |||||
REF 17 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 83). | |||||
REF 18 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 080439. | |||||
REF 19 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016149. | |||||
REF 20 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 534). | |||||
REF 21 | Sustained pain relief with dihydroergotamine in migraine is potentially due to persistent binding to 5-HT1B and 5-HT1D receptors. . The Journal of Headache and Pain 201314(Suppl 1):P75. | |||||
REF 22 | Pharmacologic management of Alzheimer disease, Part II: Antioxidants, antihypertensives, and ergoloid derivatives. Ann Pharmacother. 1999 Feb;33(2):188-97. | |||||
REF 23 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 965). | |||||
REF 24 | A systematic review of the efficacy of domperidone for the treatment of diabetic gastroparesis. Clin Gastroenterol Hepatol. 2008 Jul;6(7):726-33. | |||||
REF 25 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 940). | |||||
REF 26 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. | |||||
REF 27 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7172). | |||||
REF 28 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 072123. | |||||
REF 29 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 556). | |||||
REF 30 | The effect of alpha-2 adrenergic agonists on memory and cognitive flexibility. Cogn Behav Neurol. 2006 Dec;19(4):204-7. | |||||
REF 31 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 148). | |||||
REF 32 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 006035. | |||||
REF 33 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 85). | |||||
REF 34 | Drug information of Fluspirilene, 2008. eduDrugs. | |||||
REF 35 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 86). | |||||
REF 36 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 87). | |||||
REF 37 | Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92. | |||||
REF 38 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3639). | |||||
REF 39 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 43). | |||||
REF 40 | Lisuride, a dopamine receptor agonist with 5-HT2B receptor antagonist properties: absence of cardiac valvulopathy adverse drug reaction reports supports the concept of a crucial role for 5-HT2B receptor agonism in cardiac valvular fibrosis. Clin Neuropharmacol. 2006 Mar-Apr;29(2):80-6. | |||||
REF 41 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019 | |||||
REF 42 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7461). | |||||
REF 43 | Mullard A: 2010 FDA drug approvals. Nat Rev Drug Discov. 2011 Feb;10(2):82-5. | |||||
REF 44 | Pharmacological profile of lurasidone, a novel antipsychotic agent with potent 5-hydroxytryptamine 7 (5-HT7) and 5-HT1A receptor activity. J Pharmacol Exp Ther. 2010 Jul;334(1):171-81. | |||||
REF 45 | New drugs for type 2 diabetes mellitus: what is their place in therapy Drugs. 2008;68(15):2131-62. | |||||
REF 46 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7227). | |||||
REF 47 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016774. | |||||
REF 48 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7229). | |||||
REF 49 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 080722. | |||||
REF 50 | Pharmacotherapy for obesity. Drugs. 2005;65(10):1391-418. | |||||
REF 51 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5217). | |||||
REF 52 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070075. | |||||
REF 53 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 241). | |||||
REF 54 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070184. | |||||
REF 55 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 207). | |||||
REF 56 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 017111. | |||||
REF 57 | 2007 FDA drug approvals: a year of flux. Nat Rev Drug Discov. 2008 Feb;7(2):107-9. | |||||
REF 58 | Rotigotine: a novel dopamine agonist for the transdermal treatment of Parkinson's disease. Drugs Today (Barc). 2006 Jan;42(1):21-8. | |||||
REF 59 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 983). | |||||
REF 60 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 47). | |||||
REF 61 | Olanzapine: an updated review of its use in the management of schizophrenia. Drugs. 2001;61(1):111-61. | |||||
REF 62 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7672). | |||||
REF 63 | ClinicalTrials.gov (NCT01397786) Safety and Tolerability Study of Oral OPC-34712 as Maintenance Treatment in Adults With Schizophrenia. U.S. National Institutes of Health. | |||||
REF 64 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 48). | |||||
REF 65 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 209). | |||||
REF 66 | Methamphetamine Addiction and Abuse - Perphenazine. | |||||
REF 67 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 502). | |||||
REF 68 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040235. | |||||
REF 69 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019494) | |||||
REF 70 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 90). | |||||
REF 71 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 017473. | |||||
REF 72 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 953). | |||||
REF 73 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. | |||||
REF 74 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7279). | |||||
REF 75 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040058. | |||||
REF 76 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7286). | |||||
REF 77 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075153. | |||||
REF 78 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 50). | |||||
REF 79 | How many modes of action should an antibiotic have Curr Opin Pharmacol. 2008 Oct;8(5):564-73. | |||||
REF 80 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 96). | |||||
REF 81 | Emerging anxiolytics. Expert Opin Emerg Drugs. 2007 Nov;12(4):541-54. | |||||
REF 82 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7295). | |||||
REF 83 | Update on ropinirole in the treatment of Parkinson's disease. Neuropsychiatr Dis Treat. 2009;5:33-6. | |||||
REF 84 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 960). | |||||
REF 85 | Persistence and compliance to antidepressant treatment in patients with depression: a chart review. BMC Psychiatry. 2009 Jun 16;9:38. | |||||
REF 86 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7306). | |||||
REF 87 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 012753. | |||||
REF 88 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 100). | |||||
REF 89 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 088001. | |||||
REF 90 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 212). | |||||
REF 91 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070600. | |||||
REF 92 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7310). | |||||
REF 93 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 006403. | |||||
REF 94 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 59). | |||||
REF 95 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7559). | |||||
REF 96 | Drug information of Zuclopenthixol, 2008. eduDrugs. | |||||
REF 97 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7670). | |||||
REF 98 | CQA 206-291: a novel dopamine agonist in the treatment of Parkinson's disease. Clin Neuropharmacol. 1990 Aug;13(4):303-11. | |||||
REF 99 | Optimizing levodopa therapy for Parkinson's disease with levodopa/carbidopa/entacapone: implications from a clinical and patient perspective. Neuropsychiatr Dis Treat. 2008 February; 4(1): 39-47. | |||||
REF 100 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 101 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 102 | ClinicalTrials.gov (NCT00665223) A Study of Treatment With ACR16 in Patients With Huntington's Disease. U.S. National Institutes of Health. | |||||
REF 103 | ClinicalTrials.gov (NCT02109562) Randomized, Double-blind, Placebo Controlled, Multi-center and Tolerability of RBP-7000 in Schizophrenia Patients. U.S. National Institutes of Health. | |||||
REF 104 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3949). | |||||
REF 105 | Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42. | |||||
REF 106 | ClinicalTrials.gov (NCT01295372) Safety and Efficacy of Zicronapine in Patients With Schizophrenia. U.S. National Institutes of Health. | |||||
REF 107 | ClinicalTrials.gov (NCT01857232) Dose-finding Study of APD403 to Prevent Nausea and Vomiting After Chemotherapy. U.S. National Institutes of Health. | |||||
REF 108 | BIM-23A760, a chimeric molecule directed towards somatostatin and dopamine receptors, vs universal somatostatin receptors ligands in GH-secreting pituitary adenomas partial responders to octreotide. J Endocrinol Invest. 2005;28(11 Suppl International):21-7. | |||||
REF 109 | Emerging drugs for acromegaly. Expert Opin Emerg Drugs. 2008 Jun;13(2):273-93. | |||||
REF 110 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001412) | |||||
REF 111 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032468) | |||||
REF 112 | ClinicalTrials.gov (NCT00728195) An Efficacy and Safety Study of 3 Fixed Doses of JNJ-37822681 in Participants With Schizophrenia. U.S. National Institutes of Health. | |||||
REF 113 | Orally active benzamide antipsychotic agents with affinity for dopamine D2, serotonin 5-HT1A, and adrenergic alpha1 receptors. J Med Chem. 1998 Jun 4;41(12):1997-2009. | |||||
REF 114 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 46). | |||||
REF 115 | Pharmacological profile of the new potent neuroleptic ocaperidone (R 79,598). J Pharmacol Exp Ther. 1992 Jan;260(1):146-59. | |||||
REF 116 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 117 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005971) | |||||
REF 118 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 52). | |||||
REF 119 | Roxindole: psychopharmacological profile of a dopamine D2 autoreceptor agonist. J Pharmacol Exp Ther. 1996 Jan;276(1):41-8. | |||||
REF 120 | ClinicalTrials.gov (NCT01490086) RP5063 in Subjects With Schizophrenia or Schizoaffective Disorder. U.S. National Institutes of Health. | |||||
REF 121 | Positron emission tomographic analysis of central dopamine D1 receptor binding in normal subjects treated with the atypical neuroleptic, SDZ MAR 327. Int J Mol Med. 1998 Jan;1(1):243-7. | |||||
REF 122 | ClinicalTrials.gov (NCT03543410) A Clinical Study to Test the Effectiveness of an Investigational Drug to Treat People That Have Major Depressive Episodes When They Have Bipolar 1 Depression. U.S. National Institutes of Health. | |||||
REF 123 | ClinicalTrials.gov (NCT03544229) A Study to Evaluate the Efficacy and Safety of TAK-906 in Adult Participants With Symptomatic Idiopathic or Diabetic Gastroparesis. U.S. National Institutes of Health. | |||||
REF 124 | ClinicalTrials.gov (NCT04335357) TBR-760 in Adult Patients With Non-Functioning Pituitary Adenomas. U.S. National Institutes of Health. | |||||
REF 125 | ClinicalTrials.gov (NCT01171313) A Efficacy, Safety and Pharmacokinetic Study of XP21279 and Sinemet in Parkinson's Disease Subjects. U.S. National Institutes of Health. | |||||
REF 126 | Pharmacologic properties of (-)-3PPP (preclamol) in man. J Neural Transm Gen Sect. 1992;88(3):165-75. | |||||
REF 127 | 1192U90 in animal tests that predict antipsychotic efficacy, anxiolysis, and extrapyramidal side effects. Neuropsychopharmacology. 1996 Sep;15(3):231-42. | |||||
REF 128 | Small Molecule Therapeutics for Schizophrenia, Sylvain Celanire. Page(30). | |||||
REF 129 | Pharmacokinetics and first clinical experiences with an antihypertensive dopamine (DA2) agonist. Eur Heart J. 1992 Sep;13 Suppl D:121-8. | |||||
REF 130 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031195) | |||||
REF 131 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031909) | |||||
REF 132 | ClinicalTrials.gov (NCT04541082) Phase I Study of Oral ONC206 in Recurrent and Rare Primary Central Nervous System Neoplasms. U.S. National Institutes of Health. | |||||
REF 133 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032727) | |||||
REF 134 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000698) | |||||
REF 135 | 5-HT1A receptor ligands and their therapeutic applications: review of new patents.Expert Opin Ther Pat. 2018 Sep;28(9):679-689. | |||||
REF 136 | mGlu5 negative allosteric modulators: a patent review (2013 - 2016).Expert Opin Ther Pat. 2017 Jun;27(6):691-706. | |||||
REF 137 | Caspase inhibitors: a review of recently patented compounds (2013-2015).Expert Opin Ther Pat. 2018 Jan;28(1):47-59. | |||||
REF 138 | Drug information of Fencamfamine, 2008. eduDrugs. | |||||
REF 139 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 968). | |||||
REF 140 | Behavioral responses of dopamine beta-hydroxylase knockout mice to modafinil suggest a dual noradrenergic-dopaminergic mechanism of action. Pharmacol Biochem Behav. 2008 Dec;91(2):217-22. | |||||
REF 141 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4792). | |||||
REF 142 | Pharmacology of the atypical antipsychotic remoxipride, a dopamine D2 receptor antagonist. CNS Drug Rev. 2001 Fall;7(3):265-82. | |||||
REF 143 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 98). | |||||
REF 144 | Sertindole: efficacy and safety in schizophrenia. Expert Opin Pharmacother. 2006 Sep;7(13):1825-34. | |||||
REF 145 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015146) | |||||
REF 146 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003364) | |||||
REF 147 | Anti-obesity drugs and neural circuits of feeding. Trends Pharmacol Sci. 2008 Apr;29(4):208-17. | |||||
REF 148 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005232) | |||||
REF 149 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007055) | |||||
REF 150 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002585) | |||||
REF 151 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002657) | |||||
REF 152 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025560) | |||||
REF 153 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001388) | |||||
REF 154 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000647) | |||||
REF 155 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016551) | |||||
REF 156 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001422) | |||||
REF 157 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025217) | |||||
REF 158 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009651) | |||||
REF 159 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008736) | |||||
REF 160 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026348) | |||||
REF 161 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024498) | |||||
REF 162 | S32504, a novel naphtoxazine agonist at dopamine D3/D2 receptors: II. Actions in rodent, primate, and cellular models of antiparkinsonian activity ... J Pharmacol Exp Ther. 2004 Jun;309(3):921-35. | |||||
REF 163 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6077). | |||||
REF 164 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002423) | |||||
REF 165 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025731) | |||||
REF 166 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006596) | |||||
REF 167 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004095) | |||||
REF 168 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025558) | |||||
REF 169 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027143) | |||||
REF 170 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009126) | |||||
REF 171 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003368) | |||||
REF 172 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005079) | |||||
REF 173 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002902) | |||||
REF 174 | NNC-19-1228 and NNC 22-0031, novel neuroleptics with a "mesolimbic-selective" behavioral profile. Psychopharmacology (Berl). 1997 Jan;129(2):168-78. | |||||
REF 175 | ORG 10490: A new antipsychotic drug with 5-HT2 and DA antagonistic properties. ScienceDirect, Volume 6, Issue 2, January 1992, Pages 111. | |||||
REF 176 | The dopamine stabilizer (-)-OSU6162 occupies a subpopulation of striatal dopamine D2/D3 receptors: an [(11)C]raclopride PET study in healthy human subjects. Neuropsychopharmacology. 2015 Jan;40(2):472-9. | |||||
REF 177 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001430) | |||||
REF 178 | Pharmacokinetics, Pharmacodynamics and Tolerance of SLV 307 After Single Oral Administration in Healthy Male Volunteers. Clinical Pharmacology & Therapeutics. 02/1999; 65(2). | |||||
REF 179 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001374) | |||||
REF 180 | Atypical antipsychotics: mechanism of action. Can J Psychiatry. 2002 Feb;47(1):27-38. | |||||
REF 181 | Specific therapeutic actions of acetophenazine, perphenazine, and benzquinamide in newly admitted schizophrenic patients. Clin Pharmacol Ther. 1967 Mar-Apr;8(2):249-55. | |||||
REF 182 | Mechanism of action of atypical antipsychotic drugs and the neurobiology of schizophrenia. CNS Drugs. 2006;20(5):389-409. | |||||
REF 183 | Amisulpride: a review of its use in the management of schizophrenia. CNS Drugs. 2004;18(13):933-56. | |||||
REF 184 | Anxiolytic effects of aniracetam in three different mouse models of anxiety and the underlying mechanism. Eur J Pharmacol. 2001 May 18;420(1):33-43. | |||||
REF 185 | Dopamine D(2/3) receptor occupancy of apomorphine in the nonhuman primate brain--a comparative PET study with [11C]raclopride and [11C]MNPA. Synapse. 2009 May;63(5):378-89. | |||||
REF 186 | Aripiprazole acts as a selective dopamine D2 receptor partial agonist. Expert Opin Investig Drugs. 2007 Jun;16(6):771-5. | |||||
REF 187 | Determination of bevantolol in human plasma by high performance liquid chromatography using solid phase extraction technique. Arch Pharm Res. 2007 Jul;30(7):890-7. | |||||
REF 188 | Different changes of plasma membrane beta-adrenoceptors in rat heart after chronic administration of propranolol, atenolol and bevantolol. Life Sci. 2007 Jul 12;81(5):399-404. | |||||
REF 189 | Striatal dopamine predicts outcome-specific reversal learning and its sensitivity to dopaminergic drug administration. J Neurosci. 2009 Feb 4;29(5):1538-43. | |||||
REF 190 | The behavioral toxicity of bromocriptine in patients with psychiatric illness. J Clin Psychopharmacol. 1989 Dec;9(6):417-22. | |||||
REF 191 | Role of D1 and D2 receptors in the regulation of voluntary movements. Bull Exp Biol Med. 2008 Jul;146(1):14-7. | |||||
REF 192 | Protection against paraquat and A53T alpha-synuclein toxicity by cabergoline is partially mediated by dopamine receptors. J Neurol Sci. 2009 Mar 15;278(1-2):44-53. | |||||
REF 193 | Comparison of dosage ranges of carphenazine and trifluoperazine in elderly chronic schizophrenics. Dis Nerv Syst. 1968 Oct;29(10):695-7. | |||||
REF 194 | Modulatory role of dopamine D2 receptors and fundamental role of L-type Ca2+ channels in the induction of long-term potentiation in the basolateral... Eur J Pharmacol. 2009 Mar 15;606(1-3):90-3. | |||||
REF 195 | Basolateral amygdala D1- and D2-dopaminergic system promotes the formation of long-term potentiation in the dentate gyrus of anesthetized rats. Prog Neuropsychopharmacol Biol Psychiatry. 2009 Apr 30;33(3):552-6. | |||||
REF 196 | Behavioral and neurochemical methods in research on new psychotropics. Ann Pharm Fr. 1998;56(2):54-9. | |||||
REF 197 | Potential utility of histamine H3 receptor antagonist pharmacophore in antipsychotics. Bioorg Med Chem Lett. 2009 Jan 15;19(2):538-42. | |||||
REF 198 | Effect of ibopamine on aqueous humor production in normotensive humans. Invest Ophthalmol Vis Sci. 2003 Nov;44(11):4853-8. | |||||
REF 199 | Current and prospective pharmacological targets in relation to antimigraine action. Naunyn Schmiedebergs Arch Pharmacol. 2008 Oct;378(4):371-94. | |||||
REF 200 | Screening of domperidone in wastewater by high performance liquid chromatography and solid phase extraction methods. Talanta. 2006 Jan 15;68(3):928-31. | |||||
REF 201 | The significance of disordered gastric emptying. Z Gastroenterol. 1986 Sep;24 Suppl 2:45-54. | |||||
REF 202 | The Detection of Dopamine Gene Receptors (DRD1-DRD5) Expression on Human Peripheral Blood Lymphocytes by Real Time PCR. Iran J Allergy Asthma Immunol. 2004 Dec;3(4):169-74. | |||||
REF 203 | Polymorphisms in dopamine receptor DRD1 and DRD2 genes and psychopathological and extrapyramidal symptoms in patients on long-term antipsychotic treatment. Am J Med Genet B Neuropsychiatr Genet. 2007Sep 5;144B(6):809-15. | |||||
REF 204 | Alpha-adrenergic blockade: a possible mechanism of tocolytic action of certain benzodiazepines in a postpartum rat model in vivo. Life Sci. 2003 Jan 24;72(10):1093-102. | |||||
REF 205 | Agonist profile of ergometrine (ergonovine) on a population of postsynaptic alpha-adrenoceptors. J Pharm Pharmacol. 1988 Feb;40(2):137-9. | |||||
REF 206 | Inhibition of glutamate release by fluspirilene in cerebrocortical nerve terminals (synaptosomes). Synapse. 2002 Apr;44(1):36-41. | |||||
REF 207 | Dopaminergic synapses in the matrix of the ventrolateral striatum after chronic haloperidol treatment. Synapse. 2002 Aug;45(2):78-85. | |||||
REF 208 | Ibopamine. A preliminary review of its pharmacodynamic and pharmacokinetic properties and therapeutic efficacy. Drugs. 1988 Jul;36(1):11-31. | |||||
REF 209 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
REF 210 | Fibrotic heart-valve reactions to dopamine-agonist treatment in Parkinson's disease. Lancet Neurol. 2007 Sep;6(9):826-9. | |||||
REF 211 | Medical management of levodopa-associated motor complications in patients with Parkinson's disease. CNS Drugs. 2007;21(8):677-92. | |||||
REF 212 | Tolerance to some behavioural effects of lisuride, a dopamine receptor agonist, and reverse tolerance to others, after repeated administration. Neuropharmacology. 1985 Mar;24(3):199-206. | |||||
REF 213 | Remoxipride in Parkinson's disease: differential response in patients with dyskinesias fluctuations versus psychosis. Clin Neuropharmacol. 1995 Feb;18(1):39-45. | |||||
REF 214 | Specific in vitro and in vivo binding of 3H-raclopride. A potent substituted benzamide drug with high affinity for dopamine D-2 receptors in the rat brain. Biochem Pharmacol. 1985 Jul 1;34(13):2251-9. | |||||
REF 215 | The effects of antipsychotic drugs on Fos protein expression in the prefrontal cortex: cellular localization and pharmacological characterization. Neuroscience. 1996 Jan;70(2):377-89. | |||||
REF 216 | Present state of alpha- and beta-adrenergic drugs I. The adrenergic receptor. Am Heart J. 1976 Nov;92(5):661-4. | |||||
REF 217 | Intrinsic efficacy of antipsychotics at human D2, D3, and D4 dopamine receptors: identification of the clozapine metabolite N-desmethylclozapine as... J Pharmacol Exp Ther. 2005 Dec;315(3):1278-87. | |||||
REF 218 | Alpha1-adrenoceptor stimulation enhances experimental gastric carcinogenesis induced by N-methyl-N'-nitro-N-nitrosoguanidine in Wistar rats. Int J Cancer. 1998 Jul 29;77(3):467-9. | |||||
REF 219 | Centrally acting antihypertensive agents: an update. J Clin Hypertens (Greenwich). 2007 May;9(5):399-405. | |||||
REF 220 | Mechanisms for metoclopramide-mediated sensitization and haloperidol-induced catalepsy in rats. Eur J Pharmacol. 2008 Jun 10;587(1-3):181-6. | |||||
REF 221 | Molindone for schizophrenia and severe mental illness. Cochrane Database Syst Rev. 2007 Jan 24;(1):CD002083. | |||||
REF 222 | Antipsychotic drugs which elicit little or no parkinsonism bind more loosely than dopamine to brain D2 receptors, yet occupy high levels of these receptors. Mol Psychiatry. 1998 Mar;3(2):123-34. | |||||
REF 223 | Decongestants in treatment of nasal obstruction. Otolaryngol Pol. 1999;53(3):347-52. | |||||
REF 224 | Effects of brexpiprazole, a novel serotonin-dopamine activity modulator, on phencyclidine-induced cognitive deficits in mice: a role for serotonin 5-HT1A receptors.Pharmacol Biochem Behav.2014 Sep;124:245-9. | |||||
REF 225 | Brexpiprazole: First Global Approval.Drugs.2015 Sep;75(14):1687-97. | |||||
REF 226 | Synthesis and in vitro binding of N-phenyl piperazine analogs as potential dopamine D3 receptor ligands. Bioorg Med Chem. 2005 Jan 3;13(1):77-87. | |||||
REF 227 | CYP2D6 and DRD2 genes differentially impact pharmacodynamic sensitivity and time course of prolactin response to perphenazine. Pharmacogenet Genomics. 2007 Nov;17(11):989-93. | |||||
REF 228 | A cross-validation study on the relationship between central D2 receptor occupancy and serum perphenazine concentration. Psychopharmacology (Berl). 2004 Sep;175(2):148-53. | |||||
REF 229 | Catecholamine-secreting neuroblastoma in a 4-month-old infant: perioperative management. J Clin Anesth. 2009 Feb;21(1):54-6. | |||||
REF 230 | Nesfatin-1 exerts cardiovascular actions in brain: possible interaction with the central melanocortin system. Am J Physiol Regul Integr Comp Physiol. 2009 Aug;297(2):R330-6. | |||||
REF 231 | MMP-2 induced vein relaxation via inhibition of [Ca2+]e-dependent mechanisms of venous smooth muscle contraction. Role of RGD peptides. J Surg Res. 2010 Apr;159(2):755-64. | |||||
REF 232 | Intracellular Ca2+ and adrenergic responsiveness of cardiac myocytes in streptozotocin-induced diabetes. Clin Exp Pharmacol Physiol. 1999 Apr;26(4):347-53. | |||||
REF 233 | Dopamine/serotonin receptor ligands. 9. Oxygen-containing midsized heterocyclic ring systems and nonrigidized analogues. A step toward dopamine D5 ... J Med Chem. 2004 Aug 12;47(17):4155-8. | |||||
REF 234 | [The benzamides tiapride, sulpiride, and amisulpride in treatment for Tourette's syndrome]. Nervenarzt. 2007 Mar;78(3):264, 266-8, 270-1. | |||||
REF 235 | In vitro and in vivo characteristics of prochlorperazine oral disintegrating film. Int J Pharm. 2009 Feb 23;368(1-2):98-102. | |||||
REF 236 | Tardive dyskinesia as a result of long-term prochlorperazine use. South Med J. 1996 Oct;89(10):989-91. | |||||
REF 237 | Cetirizine/pseudoephedrine. Drugs. 2001;61(15):2231-40; discussion 2241-2. | |||||
REF 238 | Drugs for cough and cold symptoms in hypertensive patients. Am Fam Physician. 1985 Mar;31(3):183-7. | |||||
REF 239 | Receptor reserve-dependent properties of antipsychotics at human dopamine D2 receptors. Eur J Pharmacol. 2009 Apr 1;607(1-3):35-40. | |||||
REF 240 | Effect of dopamine receptor agonists on sensory nerve activity: possible therapeutic targets for the treatment of asthma and COPD. Br J Pharmacol. 2002 Jun;136(4):620-8. | |||||
REF 241 | Randomized clinical comparison of perospirone and risperidone in patients with schizophrenia: Kansai Psychiatric Multicenter Study. Psychiatry Clin Neurosci. 2009 Jun;63(3):322-8. | |||||
REF 242 | Upcoming agents for the treatment of schizophrenia: mechanism of action, efficacy and tolerability. Drugs. 2008;68(16):2269-92. | |||||
REF 243 | The treatment of Tourette's syndrome: current opinions. Expert Opin Pharmacother. 2002 Jul;3(7):899-914. | |||||
REF 244 | D(2) dopamine receptors enable delta(9)-tetrahydrocannabinol induced memory impairment and reduction of hippocampal extracellular acetylcholine concentration. Br J Pharmacol. 2000 Jul;130(6):1201-10. | |||||
REF 245 | Antiemetic specificity of dopamine antagonists. Psychopharmacology (Berl). 1982;78(3):210-3. | |||||
REF 246 | Torecan-induced neuroleptic malignant syndrome. Harefuah. 1990 May 15;118(10):576-8. | |||||
REF 247 | Antipsychotics lack alpha 1A/B adrenoceptor subtype selectivity in the rat. Eur Neuropsychopharmacol. 2005 Mar;15(2):231-4. | |||||
REF 248 | Models of drug treatment in the attention deficit disorder with hyperactivity. Rev Neurol. 2002 Feb;34 Suppl 1:S98-S106. | |||||
REF 249 | Dopaminergic stimulation of cAMP accumulation in cultured rat mesangial cells. Am J Physiol. 1987 Aug;253(2 Pt 2):H358-64. | |||||
REF 250 | Comparative effects of tolazoline and nitroprusside on human isolated radial artery. Ann Thorac Surg. 2006 Jan;81(1):125-31. | |||||
REF 251 | Striatal and extrastriatal D2/D3-receptor-binding properties of ziprasidone: a positron emission tomography study with [18F]Fallypride and [11C]raclopride (D2/D3-receptor occupancy of ziprasidone). JClin Psychopharmacol. 2008 Dec;28(6):608-17. | |||||
REF 252 | An ethopharmacological assessment of the effects of zuclopenthixol on agonistic interactions in male mice. Methods Find Exp Clin Pharmacol. 1999 Jan-Feb;21(1):11-5. | |||||
REF 253 | Effects of talipexole on emesis-related changes in abdominal afferent vagal activity and ileal serotonin metabolism in rats. Res Commun Mol Pathol Pharmacol. 1997 Jan;95(1):67-82. | |||||
REF 254 | The antiparkinsonian activity of CQA 206-291, a new D2 dopamine receptor agonist. Clin Neuropharmacol. 1989 Feb;12(1):55-9. | |||||
REF 255 | Emerging drugs for restless legs syndrome. Expert Opin Emerg Drugs. 2005 Aug;10(3):537-52. | |||||
REF 256 | Pharmacology of pramipexole, a dopamine D3-preferring agonist useful in treating Parkinson's disease. Clin Neuropharmacol. 1998 May-Jun;21(3):141-51. | |||||
REF 257 | Efficacy and safety of the dopaminergic stabilizer Pridopidine (ACR16) in patients with Huntington's disease. Clin Neuropharmacol. 2010 Sep-Oct;33(5):260-4. | |||||
REF 258 | Synthesis and evaluation of a set of 4-phenylpiperidines and 4-phenylpiperazines as D2 receptor ligands and the discovery of the dopaminergic stabi... J Med Chem. 2010 Mar 25;53(6):2510-20. | |||||
REF 259 | Population pharmacokinetics and prediction of dopamine D2 receptor occupancy after multiple doses of RBP-7000, a new sustained-release formulation of risperidone, in schizophrenia patients on stable oral risperidone treatment. Clin Pharmacokinet. 2014 Jun;53(6):533-43. | |||||
REF 260 | Clinical pipeline report, company report or official report of Lundbeck. | |||||
REF 261 | Dual ligands targeting dopamine D2 and serotonin 5-HT1A receptors as new antipsychotical or anti-Parkinsonian agents.Curr Med Chem.2014;21(4):437-57. | |||||
REF 262 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 215). | |||||
REF 263 | Aplindore (DAB-452), a high affinity selective dopamine D2 receptor partial agonist. Eur J Pharmacol. 2006 Dec 15;552(1-3):36-45. | |||||
REF 264 | Biochemical and pharmacological characterization of the putative dopamine autoreceptor agonist benzopyranopyridine, CGS 15873A. Article first published online: 5 OCT 2004. | |||||
REF 265 | Clinical pipeline report, company report or official report of Clera Inc. | |||||
REF 266 | Population pharmacokinetics of JNJ-37822681, a selective fast-dissociating dopamine D receptor antagonist, in healthy subjects and subjects with schizophrenia and dose selection based on simulated D receptor occupancy. Clin Pharmacokinet. 2013 Nov;52(11):1005-15. | |||||
REF 267 | Anxiolytic effects of dopamine receptor ligands: I. Involvement of dopamine autoreceptors. Life Sci. 1998;62(7):649-63. | |||||
REF 268 | Indolebutylamines as selective 5-HT(1A) agonists. J Med Chem. 2004 Sep 9;47(19):4677-83. | |||||
REF 269 | Drug Development in Schizophrenia: Summary and Table. Pharmaceutical Medicine October 2014, Volume 28, Issue 5, pp 265-271 | |||||
REF 270 | EFFICACY AND SAFETY OF NOVEL DOPAMINE SEROTONIN STABILIZER RP 5063 IN ACUTE SCHIZOPHRENIA AND SCHIZOAFFECTIVE DISORDER. Schizophrenia Research Volume 153, Supplement 1, April 2014, Pages S22. | |||||
REF 271 | DOI: 10.1038/sj.mp.4002062 | |||||
REF 272 | Safety, Pharmacokinetics, and Pharmacodynamics of Trazpiroben (TAK-906), a Novel Selective D 2 /D 3 Receptor Antagonist: A Phase 1 Randomized, Placebo-Controlled Single- and Multiple-Dose Escalation Study in Healthy Participants. Clin Pharmacol Drug Dev. 2021 Jan 18. | |||||
REF 273 | TBR-760, a Dopamine-Somatostatin Compound, Arrests Growth of Aggressive Nonfunctioning Pituitary Adenomas in Mice. Endocrinology. 2020 Aug 1;161(8):bqaa101. | |||||
REF 274 | Double-blind study of the actively transported levodopa prodrug XP21279 in Parkinson's disease. Mov Disord. 2014 Jan;29(1):75-82. | |||||
REF 275 | 7-[3-(1-piperidinyl)propoxy]chromenones as potential atypical antipsychotics. 2. Pharmacological profile of 7-[3-[4-(6-fluoro-1, 2-benzisoxazol-3-yl)-piperidin-1-yl]propoxy]-3-(hydroxymeth yl)chromen -4-one (abaperidone, FI-8602). J Med Chem. 1998 Dec 31;41(27):5402-9. | |||||
REF 276 | Pharmacological characteristics of ATI-9242, a Novel Atypical Antipsychotic. FASEB J, April, 2010, 24(Meeting Abstract Supplement),773.12. | |||||
REF 277 | Neurohumoral response to carmoxirole, a selective dopamine (D2) receptor agonist, in patients with chronic moderate heart failure. Cardiovasc Drugs Ther. 1998 Sep;12(4):387-94. | |||||
REF 278 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031195) | |||||
REF 279 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031909) | |||||
REF 280 | ONC206, an Imipridone Derivative, Induces Cell Death Through Activation of the Integrated Stress Response in Serous Endometrial Cancer In Vitro. Front Oncol. 2020 Oct 20;10:577141. | |||||
REF 281 | Bi-directional modulation of BNST neurons by 5-HT: Molecular expression and functional properties of excitatory 5-HT receptor subtypes. Neuroscience. 2009 December 29; 164(4): 1776-1793. | |||||
REF 282 | SSR181507, a dopamine D receptor and 5-HT() receptor ligand: evidence for mixed anxiolytic- and antidepressant-like activities.Pharmacol Biochem Behav.2011 Jan;97(3):428-35. | |||||
REF 283 | The effects of umespirone as a potential anxiolytic and antipsychotic agent. Pharmacol Biochem Behav. 1991 Sep;40(1):89-96. | |||||
REF 284 | Modeling of brain D2 receptor occupancy-plasma concentration relationships with a novel antipsychotic, YKP1358, using serial PET scans in healthy volunteers. Clin Pharmacol Ther. 2007 Feb;81(2):252-8. | |||||
REF 285 | Progress in the development of histamine H3 receptor antagonists/inverse agonists: a patent review (2013-2017).Expert Opin Ther Pat. 2018 Mar;28(3):175-196. | |||||
REF 286 | Novel serotonin receptor 2 (5-HT2R) agonists and antagonists: a patent review (2004-2014).Expert Opin Ther Pat. 2016;26(1):89-106. | |||||
REF 287 | Dopamine uptake inhibiting versus dopamine releasing properties of fencamfamine: an in vitro study. Biochem Pharmacol. 1983 Aug 1;32(15):2329-31. | |||||
REF 288 | A role for medial prefrontal dopaminergic innervation in instrumental conditioning. J Neurosci. 2009 May 20;29(20):6599-606. | |||||
REF 289 | Pharmacologically induced, subsecond dopamine transients in the caudate-putamen of the anesthetized rat. Synapse. 2007 Jan;61(1):37-9. | |||||
REF 290 | Dopamine D2 receptors: a potential pharmacological target for nomifensine and tranylcypromine but not other antidepressant treatments. Pharmacol Biochem Behav. 1995 Aug;51(4):565-9. | |||||
REF 291 | Effect of sertindole on extracellular dopamine, acetylcholine, and glutamate in the medial prefrontal cortex of conscious rats: a comparison with r... Psychopharmacology (Berl). 2009 Sep;206(1):39-49. | |||||
REF 292 | Dopamine D2(High) receptors moderately elevated by sertindole. Synapse. 2008 May;62(5):389-93. | |||||
REF 293 | Bifeprunox: a partial agonist at dopamine D2 and serotonin 1A receptors, influences nicotine-seeking behaviour in response to drug-associated stimuli in rats.Addict Biol.2012 Mar;17(2):274-86. | |||||
REF 294 | Emerging drugs for bipolar disorder. Expert Opin Emerg Drugs. 2006 Nov;11(4):621-34. | |||||
REF 295 | Effect of nolomirole on monocrotaline-induced heart failure. Pharmacol Res. 2004 Jan;49(1):1-5. | |||||
REF 296 | The role of the novel D2/beta2-agonist, Viozan (sibenadet HCl), in the treatment of symptoms of chronic obstructive pulmonary disease: results of a... Respir Med. 2003 Jan;97 Suppl A:S23-33. | |||||
REF 297 | 3-Benzisothiazolylpiperazine derivatives as potential atypical antipsychotic agents. J Med Chem. 1996 Jan 5;39(1):143-8. | |||||
REF 298 | Therapeutic effects of dopamine D1/D2 receptor agonists on detrusor hyperreflexia in 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine-lesioned parkinso... J Pharmacol Exp Ther. 1998 Jul;286(1):228-33. | |||||
REF 299 | Pharmacokinetics and central nervous system toxicity of declopramide (3-chloroprocainamide) in rats and mice. Anticancer Drugs. 1999 Jan;10(1):79-88. | |||||
REF 300 | Development of dopaminergic drugs for the chronic treatment of congestive heart failure. J Auton Pharmacol. 1990;10 Suppl 1:s85-93. | |||||
REF 301 | A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem. 1994 Apr 15;37(8):1060-2. | |||||
REF 302 | Comparison between the pharmacology of dopamine receptors mediating the inhibition of cell firing in rat brain slices through the substantia nigra pars compacta and ventral tegmental area. Br J Pharmacol. 1994 Jul;112(3):873-80. | |||||
REF 303 | CA patent application no. 648479, Implants for the treatment of dopamine associated states. | |||||
REF 304 | Savoxepine: striatal dopamine-D2 receptor occupancy in human volunteers measured using positron emission tomography (PET). Eur J Clin Pharmacol. 1993;44(2):135-40. | |||||
REF 305 | SLV310, a novel, potential antipsychotic, combining potent dopamine D2 receptor antagonism with serotonin reuptake inhibition. Bioorg Med Chem Lett. 2003 Feb 10;13(3):405-8. | |||||
REF 306 | Clinical pipeline report, company report or official report of Avarx. | |||||
REF 307 | A comparison of the neuro-endocrinological and temperature effects of DU 29894, flesinoxan, sulpiride and haloperidol in normal volunteers. Br J Clin Pharmacol. 1995 Jan;39(1):7-14. | |||||
REF 308 | The dopaminergic stabilizers pridopidine and ordopidine enhance cortico-striatal Arc gene expression. J Neural Transm. 2014 Nov;121(11):1337-47. | |||||
REF 309 | S18327 (1-[2-[4-(6-fluoro-1, 2-benzisoxazol-3-yl)piperid-1-yl]ethyl]3-phenyl imidazolin-2-one), a novel, potential antipsychotic displaying marked antagonist properties at alpha(1)- and alpha(2)-adrenergic receptors: I. Receptorial, neurochemical, and electrophysiological profile. J Pharmacol Exp Ther. 2000 Jan;292(1):38-53. | |||||
REF 310 | SDZ GLC 756, a novel octahydrobenzo[g]quinoline derivative exerts opposing effects on dopamine D1 and D2 receptors. J Neural Transm. 1996;103(1-2):17-30. | |||||
REF 311 | Synthesis and dual D2 and 5-HT1A receptor binding affinities of 7-piperazinyl and 7-piperidinyl-3,4-dihydroquinazolin-2(1H)-ones. Med Chem. 2014;10(5):484-96. | |||||
REF 312 | F15063, a potential antipsychotic with dopamine D(2)/D(3) antagonist, 5-HT(1A) agonist and D(4) partial agonist properties: (IV) duration of brain D2-like receptor occupancy and antipsychotic-like activity versus plasma concentration in mice.Naunyn Schmiedebergs Arch Pharmacol.2007 Jun;375(4):241-50. | |||||
REF 313 | Schizophrenia, "just the facts" 5. Treatment and prevention. Past, present, and future. Schizophr Res. 2010 Sep;122(1-3):1-23. | |||||
REF 314 | (1R,3S)-1-(aminomethyl)-3,4-dihydro-5,6-dihydroxy-3-phenyl-1H-2-benzopyran: a potent and selective D1 agonist. J Med Chem. 1990 Nov;33(11):2948-50. | |||||
REF 315 | Designed multiple ligands. An emerging drug discovery paradigm. J Med Chem. 2005 Oct 20;48(21):6523-43. | |||||
REF 316 | ACP-103, a 5-HT2A/2C inverse agonist, potentiates haloperidol-induced dopamine release in rat medial prefrontal cortex and nucleus accumbens. Psychopharmacology (Berl). 2005 Dec;183(2):144-53. | |||||
REF 317 | BIMG 80, a novel potential antipsychotic drug: evidence for multireceptor actions and preferential release of dopamine in prefrontal cortex. J Neurochem. 1997 Jul;69(1):182-90. | |||||
REF 318 | CGP 25454A, a novel and selective presynaptic dopamine autoreceptor antagonist. Naunyn Schmiedebergs Arch Pharmacol. 1994 Sep;350(3):230-8. | |||||
REF 319 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025558) | |||||
REF 320 | Potent activation of dopamine D3/D2 heterodimers by the antiparkinsonian agents, S32504, pramipexole and ropinirole. J Neurochem. 2003 Nov;87(3):631-41. | |||||
REF 321 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009126) | |||||
REF 322 | WO patent application no. 2009,0568,11, Medicaments. | |||||
REF 323 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005079) | |||||
REF 324 | Dopamine D4 receptors in human postmortem brain tissue of normal and schizophrenic subjects. An [3]NGD-94-1 study. Schizophrenia Research Volume 29, Issues 1-2, January 1998, Pages 93. | |||||
REF 325 | Synthesis and pharmacological evaluation of the enantiomers of the dopamine autoreceptor agonist PD 135385, Bioorg. Med. Chem. Lett. 3(4):639-644 (1993). | |||||
REF 326 | Piperazinylalkyl heterocycles as potential antipsychotic agents. J Med Chem. 1995 Oct 13;38(21):4198-210. | |||||
REF 327 | Development and validation of a capillary electrophoresis method for the enantiomeric purity determination of SLV307, a basic potential antipsychotic compound. Electrophoresis. 2004 Aug;25(16):2854-9. | |||||
REF 328 | Neuroleptic properties of Y-20024, a new benzofurancarboxamide derivative. Nihon Yakurigaku Zasshi. 1989 Nov;94(5):269-80. | |||||
REF 329 | Displacement activity of bisbenzylisoquinoline alkaloids at striatal 3H-SCH 23390 and 3H-raclopride binding sites. J Nat Prod. 1992 Sep;55(9):1281-6. | |||||
REF 330 | Synthesis and structure-activity relationships of 1-aralkyl-4-benzylpiperidine and 1-aralkyl-4-benzylpiperazine derivatives as potent sigma ligands. J Med Chem. 2005 Jan 13;48(1):266-73. | |||||
REF 331 | Functional correlates of dopamine D3 receptor activation in the rat in vivo and their modulation by the selective antagonist, (+)-S 14297: 1. Activation of postsynaptic D3 receptors mediates hypothermia, whereas blockade of D2 receptors elicits prolactin secretion and catalepsy. J Pharmacol Exp Ther. 1995 Nov;275(2):885-98. | |||||
REF 332 | Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. | |||||
REF 333 | Substituted 3-phenylpiperidines: new centrally acting dopamine autoreceptor antagonists. J Med Chem. 1993 Oct 15;36(21):3188-96. | |||||
REF 334 | Conjugated enynes as nonaromatic catechol bioisosteres: synthesis, binding experiments, and computational studies of novel dopamine receptor agonis... J Med Chem. 2000 Feb 24;43(4):756-62. | |||||
REF 335 | Specific targeting of peripheral serotonin 5-HT(3) receptors. Synthesis, biological investigation, and structure-activity relationships. J Med Chem. 2009 Jun 11;52(11):3548-62. | |||||
REF 336 | 3-amino-3,4-dihydro-2H-1-benzopyran derivatives as 5-HT1A receptor ligands and potential anxiolytic agents. 2. Synthesis and quantitative structure... J Med Chem. 1996 Oct 11;39(21):4285-98. | |||||
REF 337 | Synthesis and dopamine receptor selectivity of the benzyltetrahydroisoquinoline, (R)-(+)-nor-roefractine. J Nat Prod. 1998 Jun 26;61(6):709-12. | |||||
REF 338 | R-(-)-N-alkyl-11-hydroxy-10-hydroxymethyl- and 10-methyl-aporphines as 5-HT1A receptor ligands. Bioorg Med Chem Lett. 2007 Aug 1;17(15):4128-30. | |||||
REF 339 | Synthesis and dopamine receptor affinities of N-alkyl-11-hydroxy-2-methoxynoraporphines: N-alkyl substituents determine D1 versus D2 receptor selec... J Med Chem. 2008 Feb 28;51(4):983-7. | |||||
REF 340 | Synthesis and neuropharmacological evaluation of 2-aryl- and alkylapomorphines. Bioorg Med Chem. 2008 Apr 1;16(7):3773-9. | |||||
REF 341 | Advances in development of dopaminergic aporphinoids. J Med Chem. 2007 Jan 25;50(2):171-81. | |||||
REF 342 | Synthesis and dopamine receptor affinities of enantiomers of 2-substituted apomorphines and their N-n-propyl analogues. J Med Chem. 1990 Jun;33(6):1800-5. | |||||
REF 343 | Synthesis and neuropharmacological characterization of 2-O-substituted apomorphines. Bioorg Med Chem. 2008 Apr 15;16(8):4563-8. | |||||
REF 344 | Discovery of bishomo(hetero)arylpiperazines as novel multifunctional ligands targeting dopamine D(3) and serotonin 5-HT(1A) and 5-HT(2A) receptors. J Med Chem. 2010 Jun 24;53(12):4803-7. | |||||
REF 345 | Synthesis and biological investigations of dopaminergic partial agonists preferentially recognizing the D4 receptor subtype. Bioorg Med Chem Lett. 2006 Jun 1;16(11):2955-9. | |||||
REF 346 | Synthesis of novel lactam derivatives and their evaluation as ligands for the dopamine receptors, leading to a D(4)-selective ligand. Bioorg Med Chem. 2007 Sep 1;15(17):5811-8. | |||||
REF 347 | Arylmethyloxyphenyl derivatives: small molecules displaying P-glycoprotein inhibition. J Med Chem. 2006 Nov 2;49(22):6607-13. | |||||
REF 348 | Synthesis and pharmacological evaluation of 1-(aminomethyl)-3,4-dihydro-5-hydroxy-1H-2-benzopyrans as dopamine D1 selective ligands. J Med Chem. 1991 Oct;34(10):2946-53. | |||||
REF 349 | Piperidinylpyrroles: design, synthesis and binding properties of novel and selective dopamine D4 receptor ligands. Bioorg Med Chem Lett. 1999 Nov 1;9(21):3143-6. | |||||
REF 350 | Affinity of 10-(4-methylpiperazino)dibenz[b,f]oxepins for clozapine and spiroperidol binding sites in rat brain. J Med Chem. 1982 Jul;25(7):855-8. | |||||
REF 351 | D4 dopamine receptor-selective compounds from the Chinese plant Phoebe chekiangensis, Bioorg. Med. Chem. Lett. 7(9):1207-1212 (1997). | |||||
REF 352 | Regioselective synthesis of 3-aryl substituted pyrrolidines via palladium catalyzed arylation: pharmacological evaluation for central dopaminergic and serotonergic activity, Bioorg. Med. Chem. Lett. 7(3):241-246 (1997). | |||||
REF 353 | New N-n-propyl-substituted 3-aryl- and 3-cyclohexylpiperidines as partial agonists at the D4 dopamine receptor. J Med Chem. 2003 Jan 2;46(1):161-8. | |||||
REF 354 | Synthesis and evaluation of 1,2,3,4-tetrahydro[1]benzothieno[2,3-h]isoquinolines as dopamine antagonists. J Med Chem. 1981 Sep;24(9):1107-10. | |||||
REF 355 | Halogenated boldine derivatives with enhanced monoamine receptor selectivity. J Nat Prod. 2000 Apr;63(4):480-4. | |||||
REF 356 | N-n-Propyl-substituted 3-(dimethylphenyl)piperidines display novel discriminative properties between dopamine receptor subtypes: synthesis and rece... J Med Chem. 1998 Dec 3;41(25):4933-8. | |||||
REF 357 | New generation dopaminergic agents. 7. Heterocyclic bioisosteres that exploit the 3-OH-phenoxyethylamine D2 template. Bioorg Med Chem Lett. 1999 Sep 6;9(17):2593-8. | |||||
REF 358 | New generation dopaminergic agents. 5. Heterocyclic bioisosteres that exploit the 3-OH-N1-phenylpiperazine dopaminergic template. Bioorg Med Chem Lett. 1998 Oct 6;8(19):2675-80. | |||||
REF 359 | 3-((4-(4-Chlorophenyl)piperazin-1-yl)-methyl)-1H-pyrrolo-2,3-b-pyridine: an antagonist with high affinity and selectivity for the human dopamine D4... J Med Chem. 1996 May 10;39(10):1941-2. | |||||
REF 360 | Pre- and postsynaptic dopaminergic activities of indolizidine and quinolizidine derivatives of 3-(3-hydroxyphenyl)-N-(n-propyl)piperidine (3-PPP). ... J Med Chem. 1990 Mar;33(3):1015-22. | |||||
REF 361 | 6-Hydroxy-3-n-propyl-2,3,4,5-tetrahydro-1H-3-benzazepine and analogs: new centrally acting 5-HT1A receptor agonists. J Med Chem. 1992 Oct 30;35(22):3984-90. | |||||
REF 362 | Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97. | |||||
REF 363 | Development of (S)-N6-(2-(4-(isoquinolin-1-yl)piperazin-1-yl)ethyl)-N6-propyl-4,5,6,7-tetrahydrobenzo[d]-thiazole-2,6-diamine and its analogue as a... J Med Chem. 2010 Feb 11;53(3):1023-37. | |||||
REF 364 | Synthesis and evaluation of non-catechol D-1 and D-2 dopamine receptor agonists: benzimidazol-2-one, benzoxazol-2-one, and the highly potent benzot... J Med Chem. 1987 Jul;30(7):1166-76. | |||||
REF 365 | Iodinated 2-aminotetralins and 3-amino-1-benzopyrans: ligands for dopamine D2 and D3 receptors. J Med Chem. 1994 Nov 25;37(24):4245-50. | |||||
REF 366 | Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: 1H-pyrimidin-2-one derivatives. Bioorg Med Chem Lett. 2006 Feb;16(3):490-4. | |||||
REF 367 | Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: Quinolin(di)one and benzazepin(di)one derivatives. herve.genes... Bioorg Med Chem Lett. 2006 Feb;16(3):658-62. | |||||
REF 368 | Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54. | |||||
REF 369 | Evaluation of the effects of the enantiomers of reduced haloperidol, azaperol, and related 4-amino-1-arylbutanols on dopamine and sigma receptors. J Med Chem. 1993 Nov 26;36(24):3929-36. | |||||
REF 370 | Synthesis and structure-affinity relationships of novel N-(1-ethyl-4-methylhexahydro-1,4-diazepin-6-yl)pyridine-3-carboxamides with potent serotoni... J Med Chem. 2003 Feb 27;46(5):702-15. | |||||
REF 371 | 18F-labeled benzamides for studying the dopamine D2 receptor with positron emission tomography. J Med Chem. 1993 Nov 12;36(23):3707-20. | |||||
REF 372 | Bioisosteric heterocyclic versions of 7-{[2-(4-phenyl-piperazin-1-yl)ethyl]propylamino}-5,6,7,8-tetrahydronaphthalen-2-ol: identification of highly... J Med Chem. 2008 May 22;51(10):3005-19. | |||||
REF 373 | Structurally constrained hybrid derivatives containing octahydrobenzo[g or f]quinoline moieties for dopamine D2 and D3 receptors: binding character... J Med Chem. 2008 Dec 25;51(24):7806-19. | |||||
REF 374 | Investigation of various N-heterocyclic substituted piperazine versions of 5/7-{[2-(4-aryl-piperazin-1-yl)-ethyl]-propyl-amino}-5,6,7,8-tetrahydro-... Bioorg Med Chem. 2009 Jun 1;17(11):3923-33. | |||||
REF 375 | Further delineation of hydrophobic binding sites in dopamine D(2)/D(3) receptors for N-4 substituents on the piperazine ring of the hybrid template... Bioorg Med Chem. 2010 Aug 1;18(15):5661-74. | |||||
REF 376 | Fluorinated and iodinated dopamine agents: D2 imaging agents for PET and SPECT. J Med Chem. 1993 Jan 22;36(2):221-8. | |||||
REF 377 | Substituted 5-amino-4,5,6,7-tetrahydroindazoles as partial ergoline structures with dopaminergic activity. J Med Chem. 1989 Oct;32(10):2388-96. | |||||
REF 378 | Potential antipsychotic agents 5. Synthesis and antidopaminergic properties of substituted 5,6-dimethoxysalicylamides and related compounds. J Med Chem. 1990 Apr;33(4):1155-63. | |||||
REF 379 | 2-Phenylpyrroles as conformationally restricted benzamide analogues. A new class of potential antipsychotics. 1. J Med Chem. 1987 Nov;30(11):2099-104. | |||||
REF 380 | Synthesis and pharmacological evaluation of a series of 4-piperazinylpyrazolo[3,4-b]- and -[4,3-b][1,5]benzodiazepines as potential anxiolytics. J Med Chem. 1989 Dec;32(12):2573-82. | |||||
REF 381 | Neuroleptic activity in 5-aryltetrahydro-gamma-carbolines. J Med Chem. 1980 Jun;23(6):635-43. | |||||
REF 382 | Synthesis and pharmacological evaluation of triflate-substituted analogues of clozapine: identification of a novel atypical neuroleptic. J Med Chem. 1997 Dec 5;40(25):4146-53. | |||||
REF 383 | Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. J Med Chem. 1981 Sep;24(9):1021-6. | |||||
REF 384 | Synthesis and characterization of selective dopamine D2 receptor antagonists. 2. Azaindole, benzofuran, and benzothiophene analogs of L-741,626. Bioorg Med Chem. 2010 Jul 15;18(14):5291-300. | |||||
REF 385 | Structure-activity relationship study on N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides, a class of 5-HT7 receptor agents. 2. J Med Chem. 2007 Aug 23;50(17):4214-21. | |||||
REF 386 | Structural modifications of N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides: influence on lipophilicity and 5-HT7 receptor act... J Med Chem. 2008 Sep 25;51(18):5813-22. | |||||
REF 387 | Synthesis and neuropharmacological evaluation of esters of R(-)-N-alkyl-11-hydroxy-2-methoxynoraporphines. Bioorg Med Chem Lett. 2009 Jan 1;19(1):51-3. | |||||
REF 388 | Discovery, optimization, and characterization of a novel series of dopamine D2 versus D3 receptor selective antagonists. Probe Reports from the NIH Molecular Libraries Program [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2010. | |||||
REF 389 | Discovery and characterization of a G protein-biased agonist that inhibits beta-arrestin recruitment to the D2 dopamine receptor. Mol Pharmacol. 2014 Jul;86(1):96-105. | |||||
REF 390 | Novel D3 selective dopaminergics incorporating enyne units as nonaromatic catechol bioisosteres: synthesis, bioactivity, and mutagenesis studies. J Med Chem. 2008 Nov 13;51(21):6829-38. | |||||
REF 391 | N-Substituted-2-alkyl- and 2-arylnorapomorphines: novel, highly active D2 agonists. Bioorg Med Chem. 2009 Jul 1;17(13):4756-62. | |||||
REF 392 | A functional test identifies dopamine agonists selective for D3 versus D2 receptors. Neuroreport. 1995 Jan 26;6(2):329-32. | |||||
REF 393 | Nafadotride, a potent preferential dopamine D3 receptor antagonist, activates locomotion in rodents. J Pharmacol Exp Ther. 1995 Dec;275(3):1239-46. | |||||
REF 394 | Exploring the neuroleptic substituent in octoclothepin: potential ligands for positron emission tomography with subnanomolar affinity for (1)-adre... J Med Chem. 2010 Oct 14;53(19):7021-34. | |||||
REF 395 | Neurochemical and functional characterization of the preferentially selective dopamine D3 agonist PD 128907. J Pharmacol Exp Ther. 1995 Dec;275(3):1355-66. | |||||
REF 396 | Isoindolinone enantiomers having affinity for the dopamine D4 receptor. Bioorg Med Chem Lett. 1998 Jun 16;8(12):1499-502. | |||||
REF 397 | Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3... J Med Chem. 2007 Aug 23;50(17):4135-46. | |||||
REF 398 | Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther. 2002 Nov;303(2):791-804. | |||||
REF 399 | Evaluation of cis- and trans-9- and 11-hydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridines as structurally rigid, selective D1 dopamine recepto... J Med Chem. 1995 Jan 20;38(2):318-27. | |||||
REF 400 | 4-Acetoxy-7-chloro-3-(3-(-4-[11C]methoxybenzyl)phenyl)-2(1H)-quinolone Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. | |||||
REF 401 | Atropisomeric derivatives of 2',6'-disubstituted (R)-11-phenylaporphine: selective serotonin 5-HT(7) receptor antagonists. J Med Chem. 2001 Apr 26;44(9):1337-40. | |||||
REF 402 | Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. | |||||
REF 403 | A new mechanism of allostery in a G protein-coupled receptor dimer. Nat Chem Biol. 2014 Sep;10(9):745-52. | |||||
REF 404 | Synthesis and pharmacological characterization of 1-phenyl-, 4-phenyl-, and 1-benzyl-1,2,3,4-tetrahydroisoquinolines as dopamine receptor ligands. J Med Chem. 1988 Oct;31(10):1941-6. | |||||
REF 405 | Effects of the partial dopamine receptor agonists SDZ 208-911, SDZ 208-912 and terguride on central monoamine receptors. A behavioral, biochemical and electrophysiological study. Naunyn SchmiedebergsArch Pharmacol. 1991 Sep;344(3):263-74. | |||||
REF 406 | trans-10,11-dihydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridine: a highly potent selective dopamine D1 full agonist. J Med Chem. 1990 Jun;33(6):1756-64. | |||||
REF 407 | Synthesis, structure-activity relationships, and biological properties of 1-heteroaryl-4-[omega-(1H-indol-3-yl)alkyl]piperazines, novel potential a... J Med Chem. 2005 Nov 3;48(22):6855-69. | |||||
REF 408 | Synthesis and SAR investigations for novel melanin-concentrating hormone 1 receptor (MCH1) antagonists part 2: A hybrid strategy combining key frag... J Med Chem. 2007 Aug 9;50(16):3883-90. | |||||
REF 409 | Dibenzazecine scaffold rebuilding--is the flexibility always essential for high dopamine receptor affinities Bioorg Med Chem. 2009 Oct 1;17(19):6898-907. | |||||
REF 410 | (Dipropylamino)-tetrahydronaphthofurans: centrally acting serotonin agonists and dopamine agonists-antagonists, Bioorg. Med. Chem. Lett. 7(21):2759-2764 (1997). | |||||
REF 411 | N-[2-[(substituted chroman-8-yl)oxy]ethyl]-4-(4-methoxyphenyl)butylamines: synthesis and wide range of antagonism at the human 5-HT1A receptor. J Med Chem. 1997 Apr 11;40(8):1252-7. | |||||
REF 412 | Discovery of beta-arrestin-biased dopamine D2 ligands for probing signal transduction pathways essential for antipsychotic efficacy. Proc Natl Acad Sci U S A. 2011 Nov 8;108(45):18488-93. | |||||
REF 413 | Novel 1-aminoethyl-3-arylsulfonyl-1H-pyrrolo[2,3-b]pyridines are potent 5-HT(6) agonists. Bioorg Med Chem. 2009 Jul 15;17(14):5153-63. | |||||
REF 414 | Nonconserved residues in the second transmembrane-spanning domain of the D(4) dopamine receptor are molecular determinants of D(4)-selective pharmacology. Mol Pharmacol. 2000 Jan;57(1):144-52. | |||||
REF 415 | Effect of N-alkylation on the affinities of analogues of spiperone for dopamine D2 and serotonin 5-HT2 receptors. J Med Chem. 1992 Feb 7;35(3):423-30. | |||||
REF 416 | Regulation of human D(1), d(2(long)), d(2(short)), D(3) and D(4) dopamine receptors by amiloride and amiloride analogues. Br J Pharmacol. 2000 Jul;130(5):1045-59. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.