Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T77365
(Former ID: TTDS00187)
|
|||||
Target Name |
Adenosine A2a receptor (ADORA2A)
|
|||||
Synonyms |
Adenosine receptor A2a; ADORA2; A2a Adenosine receptor; A(2A) adenosine receptor
Click to Show/Hide
|
|||||
Gene Name |
ADORA2A
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 3 Target-related Diseases | + | ||||
1 | Orthostatic hypotension [ICD-11: BA21] | |||||
2 | Parkinsonism [ICD-11: 8A00] | |||||
3 | Radionuclide imaging [ICD-11: N.A.] | |||||
Function |
The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Receptor for adenosine.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T77M4W |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 3 Approved Drugs | + | ||||
1 | Caffeine | Drug Info | Approved | Orthostatic hypotension | [2], [3] | |
2 | Istradefylline | Drug Info | Approved | Parkinson disease | [4] | |
3 | Regadenoson | Drug Info | Approved | Radionuclide imaging | [5], [6] | |
Clinical Trial Drug(s) | [+] 20 Clinical Trial Drugs | + | ||||
1 | Apadenoson | Drug Info | Phase 3 | Coronary artery disease | [7], [8] | |
2 | Binodenoson | Drug Info | Phase 3 | Hypertension | [9], [10] | |
3 | Tozadenant | Drug Info | Phase 3 | Parkinson disease | [11], [12] | |
4 | AMP-579 | Drug Info | Phase 2 | Hyperlipidaemia | [13] | |
5 | AZD4635 | Drug Info | Phase 2 | Prostate cancer | [14] | |
6 | BIIB014 | Drug Info | Phase 2 | Parkinson disease | [15], [16] | |
7 | Dexefaroxan | Drug Info | Phase 2 | Parkinson disease | [17] | |
8 | MRE-0094 | Drug Info | Phase 2 | Diabetic foot ulcer | [18] | |
9 | SCH 420814 | Drug Info | Phase 2 | Parkinson disease | [16], [19] | |
10 | Tonapofylline | Drug Info | Phase 2 | Acute and chronic heart failure | [20] | |
11 | UK-432097 | Drug Info | Phase 2 | Chronic obstructive pulmonary disease | [21], [22] | |
12 | AB928 | Drug Info | Phase 1/2 | Metastatic colorectal cancer | [23] | |
13 | ATL-313 | Drug Info | Phase 1/2 | Arteriosclerosis | [24], [25] | |
14 | OPA-6566 | Drug Info | Phase 1/2 | Glaucoma/ocular hypertension | [26] | |
15 | PBF509 | Drug Info | Phase 1/2 | Non-small-cell lung cancer | [27] | |
16 | V81444 | Drug Info | Phase 1/2 | Parkinson disease | [28] | |
17 | EOS100850 | Drug Info | Phase 1 | Solid tumour/cancer | [29] | |
18 | GW-328267 | Drug Info | Phase 1 | Allergic rhinitis | [30] | |
19 | KF-17837 | Drug Info | Phase 1 | Parkinson disease | [31] | |
20 | PBF-999 | Drug Info | Phase 1 | Solid tumour/cancer | [32] | |
Discontinued Drug(s) | [+] 5 Discontinued Drugs | + | ||||
1 | PF-1913539 | Drug Info | Discontinued in Phase 3 | Alzheimer disease | [33] | |
2 | BVT-115959 | Drug Info | Discontinued in Phase 2 | Pain | [34] | |
3 | Lu-AA47070 | Drug Info | Discontinued in Phase 1 | Parkinson disease | [35] | |
4 | T-62 | Drug Info | Discontinued in Phase 1 | Neuropathic pain | [36] | |
5 | METHYLTHIOADENOSINE | Drug Info | Terminated | Multiple sclerosis | [37] | |
Mode of Action | [+] 4 Modes of Action | + | ||||
Antagonist | [+] 13 Antagonist drugs | + | ||||
1 | Caffeine | Drug Info | [1], [38] | |||
2 | Tozadenant | Drug Info | [41] | |||
3 | AZD4635 | Drug Info | [27] | |||
4 | BIIB014 | Drug Info | [16] | |||
5 | SCH 420814 | Drug Info | [16] | |||
6 | AB928 | Drug Info | [27] | |||
7 | PBF509 | Drug Info | [27] | |||
8 | V81444 | Drug Info | [48] | |||
9 | EOS100850 | Drug Info | [49] | |||
10 | PBF-999 | Drug Info | [52] | |||
11 | PF-1913539 | Drug Info | [54], [55] | |||
12 | Lu-AA47070 | Drug Info | [57] | |||
13 | T-62 | Drug Info | [36] | |||
Modulator | [+] 5 Modulator drugs | + | ||||
1 | Istradefylline | Drug Info | [4] | |||
2 | Regadenoson | Drug Info | [39] | |||
3 | AMP-579 | Drug Info | [42] | |||
4 | GW-328267 | Drug Info | [50] | |||
5 | MSX-3 | Drug Info | [105] | |||
Agonist | [+] 9 Agonist drugs | + | ||||
1 | Apadenoson | Drug Info | [7] | |||
2 | Binodenoson | Drug Info | [40] | |||
3 | Dexefaroxan | Drug Info | [43] | |||
4 | MRE-0094 | Drug Info | [18] | |||
5 | UK-432097 | Drug Info | [45] | |||
6 | ATL-313 | Drug Info | [46] | |||
7 | OPA-6566 | Drug Info | [47] | |||
8 | BVT-115959 | Drug Info | [56] | |||
9 | CGS 21680 | Drug Info | [96] | |||
Inhibitor | [+] 225 Inhibitor drugs | + | ||||
1 | Tonapofylline | Drug Info | [44] | |||
2 | KF-17837 | Drug Info | [51] | |||
3 | SCH-442416 | Drug Info | [53] | |||
4 | ARISTEROMYCIN | Drug Info | [58] | |||
5 | METHYLTHIOADENOSINE | Drug Info | [59] | |||
6 | METRIFUDIL | Drug Info | [60] | |||
7 | ZM-241385 | Drug Info | [61] | |||
8 | (1H-Imidazo[4,5-c]quinolin-4-yl)-phenyl-amine HCl | Drug Info | [62] | |||
9 | (2R,3S)-3-(6-Amino-purin-9-yl)-nonan-2-ol | Drug Info | [63] | |||
10 | (3-amino-5-bromobenzofuran-2-yl)(phenyl)methanone | Drug Info | [64] | |||
11 | (E,E)-8-(4-Phenylbutadien-1-yl)caffeine | Drug Info | [65] | |||
12 | (E,E)-8-[4-(3-Bromophenyl)butadien-1-yl]caffeine | Drug Info | [65] | |||
13 | (E,E)-8-[4-(3-Chlorophenyl)butadien-1-yl]caffeine | Drug Info | [65] | |||
14 | (E,E)-8-[4-(3-Fluorophenyl)butadien-1-yl]caffeine | Drug Info | [65] | |||
15 | (S)-DHPA | Drug Info | [66] | |||
16 | (Z)-8-(3-chlorostyryl)caffeine | Drug Info | [65] | |||
17 | 1,3,7-Tripropyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
18 | 1,3,8-Trimethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [68] | |||
19 | 1,3-Diallyl-3,7-dihydro-purine-2,6-dione | Drug Info | [69] | |||
20 | 1,3-Diallyl-7-methyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
21 | 1,3-Dibenzyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
22 | 1,3-Diethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [69] | |||
23 | 1,3-Diisobutyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
24 | 1,3-Dipropyl-3,7-dihydro-purine-2,6-dione | Drug Info | [69] | |||
25 | 1,4-diaminoanthracene-9,10-dione | Drug Info | [64] | |||
26 | 1-Allyl-3,7-dimethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
27 | 1-amino-2,4-bis(phenylthio)anthracene-9,10-dione | Drug Info | [64] | |||
28 | 1-amino-2-phenoxyanthracene-9,10-dione | Drug Info | [64] | |||
29 | 1-amino-4-chloroanthracene-9,10-dione | Drug Info | [64] | |||
30 | 1-amino-4-methoxyanthracene-9,10-dione | Drug Info | [64] | |||
31 | 1-aminoanthracene-9,10-dione | Drug Info | [64] | |||
32 | 1-Butyl-8-phenyl-3,7-dihydro-purine-2,6-dione | Drug Info | [70] | |||
33 | 1-Ethyl-3-methyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
34 | 1-Methyl-8-phenyl-3,7-dihydro-purine-2,6-dione | Drug Info | [70] | |||
35 | 1-METHYLXANTHINE | Drug Info | [69] | |||
36 | 1-Phenyl-3-(4-pyridin-2-yl-thiazol-2-yl)-urea | Drug Info | [71] | |||
37 | 1H-Imidazo[4,5-c]quinolin-4-ylamine HCl | Drug Info | [62] | |||
38 | 2,5'-dichloro-5'-deoxy-N6-cyclopentyladenosine | Drug Info | [72] | |||
39 | 2,6,8-triphenyl-9H-purine | Drug Info | [73] | |||
40 | 2,6-diphenyl-1-deazapurine | Drug Info | [74] | |||
41 | 2,6-diphenyl-8-(1-ethylpropyl)-1-deazapurine | Drug Info | [74] | |||
42 | 2,6-diphenyl-8-ethyl-1-deazapurine | Drug Info | [74] | |||
43 | 2,6-diphenyl-8-methyl-1-deazapurine | Drug Info | [74] | |||
44 | 2,6-diphenyl-8-tButyl-1-deazapurine | Drug Info | [74] | |||
45 | 2,6-diphenyl-9H-purine | Drug Info | [73] | |||
46 | 2,6-Diphenyl-pyrimidin-4-ylamine | Drug Info | [75] | |||
47 | 2,6-dphenyl-8-propyl-1-deazapurine | Drug Info | [74] | |||
48 | 2-(1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [76] | |||
49 | 2-(2''-indolylethyloxy)adenosine | Drug Info | [77] | |||
50 | 2-(2-furyl)-6-(1H-pyrazol-1-yl)pyrimidin-4-amine | Drug Info | [78] | |||
51 | 2-(3''(5''-chloro-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
52 | 2-(3''(7''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
53 | 2-(3''-(4''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
54 | 2-(3''-(5''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
55 | 2-(3''-(5''-fluoro-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
56 | 2-(3''-(5''-hydroxyindolyl)ethyloxy)adenosine | Drug Info | [77] | |||
57 | 2-(3''-(5''-iodo-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
58 | 2-(3''-(5''-methoxy-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
59 | 2-(3''-(6''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
60 | 2-(3''-(6''-chloro-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
61 | 2-(3''-(benzoimidazole-1''-yl)ethyloxy)adenosine | Drug Info | [77] | |||
62 | 2-(3''-indolylethyloxy)adenosine | Drug Info | [77] | |||
63 | 2-(3''-pyrrolylethyloxy)adenosine | Drug Info | [77] | |||
64 | 2-(4-chlorophenyl)-6-phenyl-9H-purine | Drug Info | [73] | |||
65 | 2-(4-ethylthiobenzimidazol-2-yl)quinoxaline | Drug Info | [79] | |||
66 | 2-(4-hydroxypent-1-yl)-N6-methoxyadenosine | Drug Info | [80] | |||
67 | 2-(4-methyl-1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [76] | |||
68 | 2-(5-cyano-1-pent-1-ynyl)-N6-methoxyadenosine | Drug Info | [80] | |||
69 | 2-(6-amino-8-bromo-9H-purin-9-yl)ethanol | Drug Info | [81] | |||
70 | 2-(hex-1-ynyl)-N6-methoxyadenosine | Drug Info | [80] | |||
71 | 2-amino-3-(m-tolylamino)naphthalene-1,4-dione | Drug Info | [64] | |||
72 | 2-Amino-4,6-di-furan-2-yl-nicotinonitrile | Drug Info | [82] | |||
73 | 2-Amino-4,6-di-thiophen-2-yl-nicotinonitrile | Drug Info | [82] | |||
74 | 2-Amino-4,6-diphenyl-nicotinonitrile | Drug Info | [82] | |||
75 | 2-Amino-4,6-diphenyl-pyrimidin-5-carbonitrile | Drug Info | [75] | |||
76 | 2-Amino-4,6-diphenyl-pyrimidine | Drug Info | [75] | |||
77 | 2-Amino-4-furan-2-yl-6-phenyl-nicotinonitrile | Drug Info | [82] | |||
78 | 2-Amino-4-phenyl-6-thiophen-2-yl-nicotinonitrile | Drug Info | [82] | |||
79 | 2-Amino-6-furan-2-yl-4-phenyl-nicotinonitrile | Drug Info | [82] | |||
80 | 2-amino-6-phenyl-4-p-tolylnicotinonitrile | Drug Info | [83] | |||
81 | 2-Amino-6-phenyl-4-thiophen-2-yl-nicotinonitrile | Drug Info | [82] | |||
82 | 2-amino-N-benzyl-6-phenyl-9H-purine-9-carboxamide | Drug Info | [84] | |||
83 | 2-chloro-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [85] | |||
84 | 2-chloro-4-(thiophen-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [85] | |||
85 | 2-Cyclopentyl-1H-imidazo[4,5-c]quinolin-4-ylamine | Drug Info | [62] | |||
86 | 2-ethyl-4-(furan-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [85] | |||
87 | 2-ethyl-4-(furan-3-yl)thieno[3,2-d]pyrimidine | Drug Info | [85] | |||
88 | 2-ethyl-4-(pyridin-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [85] | |||
89 | 2-ethyl-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [85] | |||
90 | 2-ethyl-4-(thiophen-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [85] | |||
91 | 2-ethynyl-N6-methoxyadenosine | Drug Info | [80] | |||
92 | 2-m-tolyl-2H-pyrazolo[3,4-c]quinolin-4-amine | Drug Info | [86] | |||
93 | 2-p-tolyl-2H-pyrazolo[3,4-c]quinolin-4-amine | Drug Info | [86] | |||
94 | 2-Phenyl-1H-imidazo[4,5-c]quinolin-4-ylamine | Drug Info | [62] | |||
95 | 2-phenyl-2H-pyrazolo[3,4-c]quinolin-4-amine | Drug Info | [86] | |||
96 | 2-phenylpropoxyadenosine | Drug Info | [77] | |||
97 | 2-tolyl-6-phenyl-9H-purine | Drug Info | [73] | |||
98 | 2-[(4-acetylphenyl)ethynyl]-N6-methoxyadenosine | Drug Info | [80] | |||
99 | 2-[(4-fluorophenyl)ethynyl]-N6-methoxyadenosine | Drug Info | [80] | |||
100 | 3-Benzyl-7-methyl-[1,8]naphthyridin-4-ol | Drug Info | [87] | |||
101 | 3-Benzyl-7-methyl-[1,8]naphthyridine-4-thiol | Drug Info | [87] | |||
102 | 3-Isopropyl-1-methyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
103 | 3-noradamantyl-1,3-dipropylxanthine | Drug Info | [88] | |||
104 | 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [89] | |||
105 | 4-(ethylthio)-6-phenyl-1,3,5-triazin-2-amine | Drug Info | [83] | |||
106 | 4-(furan-2-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine | Drug Info | [90] | |||
107 | 4-(furan-2-yl)thieno[3,2-d]pyrimidin-2-amine | Drug Info | [84] | |||
108 | 4-(thiazol-2-yl)thieno[3,2-d]pyrimidin-2-amine | Drug Info | [85] | |||
109 | 4-Amino-2,6-diphenyl-pyrimidine-5-carbonitrile | Drug Info | [75] | |||
110 | 4-amino-2-p-tolylisoindoline-1,3-dione | Drug Info | [64] | |||
111 | 5,7-dibromo-9H-pyrido[3,4-b]indol-6-ol | Drug Info | [91] | |||
112 | 5,7-diphenyl-3H-imidazo[4,5-b]pyridin-2-ol | Drug Info | [74] | |||
113 | 5-Azido-6-benzyl-2-methyl-[1,8]naphthyridine | Drug Info | [87] | |||
114 | 5-Butyl-8-phenyl-3H-[1,2,4]triazolo[5,1-i]purine | Drug Info | [92] | |||
115 | 6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [90] | |||
116 | 6-Furan-2-yl-9-phenethyl-9H-purin-2-ylamine | Drug Info | [93] | |||
117 | 6-Furan-2-yl-9-phenyl-9H-purin-2-ylamine | Drug Info | [93] | |||
118 | 6-guanidino-2-(3''-indolylethyloxy)adenosine | Drug Info | [77] | |||
119 | 7-Allyl-1,3-dimethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
120 | 7-Allyl-1,3-dipropyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
121 | 7-Isopropyl-7H-adenine | Drug Info | [66] | |||
122 | 7-Propyl-7H-adenine | Drug Info | [66] | |||
123 | 8-Br-adenine | Drug Info | [66] | |||
124 | 8-Bromo-9-(2,3-dihydroxypropyl)-9H-adenine | Drug Info | [66] | |||
125 | 8-Bromo-9-(2-butyl)-9H-adenine | Drug Info | [66] | |||
126 | 8-Bromo-9-(2-hydroxypropyl)-9H-adenine | Drug Info | [66] | |||
127 | 8-Bromo-9-(3-hydroxypropyl)-9H-adenine | Drug Info | [66] | |||
128 | 8-Bromo-9-(but-3-enyl)-9H-adenine | Drug Info | [66] | |||
129 | 8-Bromo-9-(sec-butyl)-9H-adenine | Drug Info | [66] | |||
130 | 8-Bromo-9-cyclobutyl-9H-adenine | Drug Info | [66] | |||
131 | 8-Bromo-9-cyclohexyl-9H-adenine | Drug Info | [66] | |||
132 | 8-Bromo-9-cyclopentyl-9H-adenine | Drug Info | [66] | |||
133 | 8-Bromo-9-ethyl-9H-adenine | Drug Info | [66] | |||
134 | 8-bromo-9-isobutyl-9H-purin-6-amine | Drug Info | [81] | |||
135 | 8-Bromo-9-isopropyl-9H-adenine | Drug Info | [66] | |||
136 | 8-Bromo-9-methyl-9H-adenine | Drug Info | [66] | |||
137 | 8-Bromo-9-phenylethyl-9H-adenine | Drug Info | [66] | |||
138 | 8-Bromo-9-propyl-9H-adenine | Drug Info | [66] | |||
139 | 8-PHENYL THEOPHYLLINE | Drug Info | [62] | |||
140 | 8-Phenyl-1-propyl-3,7-dihydro-purine-2,6-dione | Drug Info | [70] | |||
141 | 8-propyl-2,6-diphenyl-9H-purine | Drug Info | [73] | |||
142 | 9-(2-Hydroxyethyl)-9H-adenine | Drug Info | [66] | |||
143 | 9-(2-Hydroxypropyl)-9H-adenine | Drug Info | [66] | |||
144 | 9-(3-aminobenzyl)-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [84] | |||
145 | 9-(3-Hydroxypropyl)-9H-adenine | Drug Info | [66] | |||
146 | 9-(3-nitrobenzyl)-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [84] | |||
147 | 9-(4-nitrobenzyl)-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [84] | |||
148 | 9-(sec-Butyl)-9H-adenine | Drug Info | [66] | |||
149 | 9-Allyl-8-bromo-9H-adenine | Drug Info | [66] | |||
150 | 9-benzyl-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [84] | |||
151 | 9-Benzyl-8-bromo-9H-adenine | Drug Info | [66] | |||
152 | 9-BENZYL-9H-ADENINE | Drug Info | [66] | |||
153 | 9-But-3-enyl-9H-adenine | Drug Info | [66] | |||
154 | 9-Butyl-9H-adenine | Drug Info | [66] | |||
155 | 9-Cyclobutyl-9H-adenine | Drug Info | [66] | |||
156 | 9-Cycloheptyl-9H-adenine | Drug Info | [66] | |||
157 | 9-Cyclopentyl-9H-adenine | Drug Info | [66] | |||
158 | 9-Cyclopropyl-9H-adenine | Drug Info | [66] | |||
159 | 9-Ethyl-8-phenylethynyl-9H-purin-6-ylamine | Drug Info | [94] | |||
160 | 9-Ethyl-9H-adenine | Drug Info | [66] | |||
161 | 9-Isopropyl-9H-adenine | Drug Info | [66] | |||
162 | 9-Methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine | Drug Info | [95] | |||
163 | 9-Methyl-9H-adenine | Drug Info | [66] | |||
164 | 9-Phenylethyl-9H-adenine | Drug Info | [66] | |||
165 | 9-Propyl-9H-adenine | Drug Info | [66] | |||
166 | Alloxazine | Drug Info | [95] | |||
167 | Cyclohexyl-(2-phenoxy-9H-purin-6-yl)-amine | Drug Info | [97] | |||
168 | Cyclohexyl-(2-phenylsulfanyl-9H-purin-6-yl)-amine | Drug Info | [97] | |||
169 | Ethyl 5-benzoyl-4-phenylthiazol-2-ylcarbamate | Drug Info | [44] | |||
170 | FR-166124 | Drug Info | [98] | |||
171 | Galangin | Drug Info | [99] | |||
172 | GNF-PF-2224 | Drug Info | [100] | |||
173 | GNF-PF-2700 | Drug Info | [81] | |||
174 | isobutylmethylxanthine | Drug Info | [67] | |||
175 | Isoguanosine | Drug Info | [101] | |||
176 | Kuanoniamine D | Drug Info | [102] | |||
177 | LUF-5417 | Drug Info | [44] | |||
178 | LUF-5433 | Drug Info | [44] | |||
179 | LUF-5437 | Drug Info | [71] | |||
180 | LUF-5767 | Drug Info | [103] | |||
181 | LUF-5956 | Drug Info | [73] | |||
182 | LUF-5957 | Drug Info | [73] | |||
183 | LUF-5962 | Drug Info | [73] | |||
184 | LUF-5978 | Drug Info | [74] | |||
185 | LUF-5980 | Drug Info | [74] | |||
186 | LUF-5981 | Drug Info | [74] | |||
187 | Methyl 7-methoxy-4-phenylbenzofuran-2-ylcarbamate | Drug Info | [104] | |||
188 | N*6*-Cyclohexyl-N*2*-phenyl-9H-purine-2,6-diamine | Drug Info | [97] | |||
189 | N-(2,6-diphenylpyrimidin-4-yl)-2-ethylbutyramide | Drug Info | [103] | |||
190 | N-(2,6-diphenylpyrimidin-4-yl)-3-methylbutyramide | Drug Info | [103] | |||
191 | N-(2,6-diphenylpyrimidin-4-yl)acetamide | Drug Info | [103] | |||
192 | N-(2,6-diphenylpyrimidin-4-yl)butyramide | Drug Info | [103] | |||
193 | N-(2,6-diphenylpyrimidin-4-yl)isobutyramide | Drug Info | [103] | |||
194 | N-(2,6-diphenylpyrimidin-4-yl)propionamide | Drug Info | [103] | |||
195 | N-(2-(furan-2-yl)-3,4'-bipyridin-6-yl)acetamide | Drug Info | [106] | |||
196 | N-(3-Phenyl-[1,2,4]thiadiazol-5-yl)-benzamide | Drug Info | [71] | |||
197 | N-(4,6-diphenylpyrimidin-2-yl)propionamide | Drug Info | [103] | |||
198 | N-(4-Pyridin-2-yl-thiazol-2-yl)-benzamide | Drug Info | [71] | |||
199 | N-(5-Benzoyl-4-phenylthiazol-2-yl)benzamide | Drug Info | [44] | |||
200 | N-(7-methoxy-4-phenylbenzofuran-2-yl)acetamide | Drug Info | [104] | |||
201 | N6-((+/-)-endo-norborn-2-yl)adenosine | Drug Info | [72] | |||
202 | N6-(4-hydroxybenzyl)adenine riboside | Drug Info | [107] | |||
203 | N6-CYCLOPENTYLADENOSINE | Drug Info | [44] | |||
204 | N6-methoxy-2-phenylethynyladenosine | Drug Info | [80] | |||
205 | N6-methoxy-2-[(2-pyridinyl)ethynyl]adenosine | Drug Info | [80] | |||
206 | N6-methoxy-2-[(3-pyridinyl)ethynyl]-adenosine | Drug Info | [80] | |||
207 | N6-methoxy-2-[(4-methoxyphenyl)ethynyl]adenosine | Drug Info | [80] | |||
208 | N6-methoxy-2-[(4-pentylphenyl)ethynyl]adenosine | Drug Info | [80] | |||
209 | N6-methoxy-2-[(4-pyridinyl)ethynyl]adenosine | Drug Info | [80] | |||
210 | N6-methoxy-2-[2-(trimethylsilyl)ethynyl]adenosine | Drug Info | [80] | |||
211 | N6-[(4-Amino)-phenyl]-9-benzyl-2-phenyladenine | Drug Info | [108] | |||
212 | N6-[(4-Nitro)-phenyl]-9-benzyl-2-phenyladenine | Drug Info | [108] | |||
213 | PD-115199 | Drug Info | [109] | |||
214 | Phenyl 7-methoxy-4-phenylbenzofuran-2-ylcarbamate | Drug Info | [104] | |||
215 | Phenyl(2-(trifluoromethyl)quinolin-4-yl)methanol | Drug Info | [110] | |||
216 | PSB-0788 | Drug Info | [111] | |||
217 | PSB-09120 | Drug Info | [111] | |||
218 | PSB-601 | Drug Info | [111] | |||
219 | R-N6-(phenylisopropyl)adenosine | Drug Info | [77] | |||
220 | SB-298 | Drug Info | [111] | |||
221 | SCH-63390 | Drug Info | [112] | |||
222 | ST-1535 | Drug Info | [82] | |||
223 | [3H]CCPA | Drug Info | [113] | |||
224 | [3H]NECA | Drug Info | [114] | |||
225 | [3H]OSIP339391 | Drug Info | [81] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Drug Binding Sites of Target | Top | |||||
---|---|---|---|---|---|---|
Ligand Name: Caffeine | Ligand Info | |||||
Structure Description | Thermostabilised adenosine A2A receptor in complex with caffeine | PDB:3RFM | ||||
Method | X-ray diffraction | Resolution | 3.60 Å | Mutation | Yes | [115] |
PDB Sequence |
SVYITVELAI
16 AVLAILGNVL26 VCWAVWLNSN36 LQNVTNYFVV46 SLAAADILVG56 VLAIPFAITI 66 STGFCAACHG76 CLFIACFVLV86 LAQSSIFSLL96 AIAIDRYIAI106 AIPLRYNGLV 116 TGTRAAGIIA126 ICWVLSFAIG136 LTPMLGWNNC146 GQPGCGEGQV164 ACLFEDVVPM 174 NYMVYFNFFA184 CVLVPLLLML194 GVYLRIFAAA204 RRQLKQMESQ214 PLPGERARST 224 LQKEVHAAKS234 AAIIAGLFAL244 CWLPLHIINC254 FTFFCPDCSH264 APLWLMYLAI 274 VLAHTNSVVN284 PFIYAYRIRE294 FRQTFRKIIR304 S
|
|||||
|
||||||
Ligand Name: Adenosine | Ligand Info | |||||
Structure Description | Thermostabilised HUMAN A2a Receptor with adenosine bound | PDB:2YDO | ||||
Method | X-ray diffraction | Resolution | 3.00 Å | Mutation | Yes | [116] |
PDB Sequence |
SSVYITVELA
15 IAVLAILGNV25 LVCWAVWLNS35 NLQNVTNYFV45 VSAAAADILV55 GVLAIPFAIA 65 ISTGFCAACH75 GCLFIACFVL85 VLTASSIFSL95 LAIAIDRYIA105 IRIPLRYNGL 115 VTGTRAKGII125 AICWVLSFAI135 GLTPMLGWNN145 CGQPKEGKAH155 SQGCGEGQVA 165 CLFEDVVPMN175 YMVYFNFFAC185 VLVPLLLMLG195 VYLRIFLAAR205 RQLKQMESTL 225 QKEVHAAKSL235 AIIVGLFALC245 WLPLHIINCF255 TFFCPDCSHA265 PLWLMYLAIV 275 LSHTNSVVNP285 FIYAYRIREF295 RQTFRKIIRS305 HVLRQQEPFK315 AAAAENLYF |
|||||
|
||||||
Click to View More Binding Site Information of This Target with Different Ligands |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Pathway Affiliation
Biological Network Descriptors
|





KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
Rap1 signaling pathway | hsa04015 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Calcium signaling pathway | hsa04020 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
cAMP signaling pathway | hsa04024 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy | ||
Vascular smooth muscle contraction | hsa04270 | Affiliated Target |
![]() |
Class: Organismal Systems => Circulatory system | Pathway Hierarchy |
Degree | 1 | Degree centrality | 1.07E-04 | Betweenness centrality | 0.00E+00 |
---|---|---|---|---|---|
Closeness centrality | 1.84E-01 | Radiality | 1.31E+01 | Clustering coefficient | 0.00E+00 |
Neighborhood connectivity | 8.00E+00 | Topological coefficient | 1.00E+00 | Eccentricity | 13 |
Download | Click to Download the Full PPI Network of This Target | ||||
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-interacting Proteins |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 7 KEGG Pathways | + | ||||
1 | Rap1 signaling pathway | |||||
2 | Calcium signaling pathway | |||||
3 | cAMP signaling pathway | |||||
4 | Neuroactive ligand-receptor interaction | |||||
5 | Vascular smooth muscle contraction | |||||
6 | Parkinson's disease | |||||
7 | Alcoholism | |||||
Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
1 | Intracellular Signalling Through Adenosine Receptor A2a and Adenosine | |||||
PID Pathway | [+] 1 PID Pathways | + | ||||
1 | HIF-2-alpha transcription factor network | |||||
Reactome | [+] 4 Reactome Pathways | + | ||||
1 | NGF-independant TRKA activation | |||||
2 | Adenosine P1 receptors | |||||
3 | G alpha (s) signalling events | |||||
4 | Surfactant metabolism | |||||
WikiPathways | [+] 7 WikiPathways | + | ||||
1 | Nucleotide GPCRs | |||||
2 | Monoamine Transport | |||||
3 | GPCRs, Class A Rhodopsin-like | |||||
4 | NGF signalling via TRKA from the plasma membrane | |||||
5 | GPCR ligand binding | |||||
6 | GPCR downstream signaling | |||||
7 | GPCRs, Other |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation | ||||||
Target QSAR Model |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Caffeine as a psychomotor stimulant: mechanism of action. Cell Mol Life Sci. 2004 Apr;61(7-8):857-72. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 407). | |||||
REF 3 | Fatigue: an overview. Am Fam Physician. 2008 Nov 15;78(10):1173-9. | |||||
REF 4 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019 | |||||
REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5596). | |||||
REF 6 | 2008 FDA drug approvals. Nat Rev Drug Discov. 2009 Feb;8(2):93-6. | |||||
REF 7 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3290). | |||||
REF 8 | ClinicalTrials.gov (NCT00990327) Study of the Safety and Efficacy of Apadenoson for Detection of Myocardial Perfusion Defects Using SPECT MPI. U.S. National Institutes of Health. | |||||
REF 9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5595). | |||||
REF 10 | ClinicalTrials.gov (NCT00944970) Efficacy and Safety Study of Binodenoson in Assessing Cardiac Ischemia. U.S. National Institutes of Health. | |||||
REF 11 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5611). | |||||
REF 12 | ClinicalTrials.gov (NCT02453386) Safety and Efficacy Study of Tozadenant to Treat End of Dose Wearing Off in Parkinson's Patients Using Levodopa. | |||||
REF 13 | Recent developments in adenosine receptor ligands and their potential as novel drugs. Biochim Biophys Acta. 2011 May; 1808(5): 1290-1308. | |||||
REF 14 | ClinicalTrials.gov (NCT04089553) An Open-label, Phase II Study of AZD4635 in Patients With Prostate Cancer. U.S. National Institutes of Health. | |||||
REF 15 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5612). | |||||
REF 16 | Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54. | |||||
REF 17 | Effects of the alpha 2-adrenoreceptor antagonist dexefaroxan on neurogenesis in the olfactory bulb of the adult rat in vivo: selective protection against neuronal death. Neuroscience. 2003;117(2):281-91. | |||||
REF 18 | Emerging drugs for diabetic foot ulcers. Expert Opin Emerg Drugs. 2006 Nov;11(4):709-24. | |||||
REF 19 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5614). | |||||
REF 20 | Emerging drugs for acute and chronic heart failure: current and future developments. Expert Opin Emerg Drugs. 2007 Mar;12(1):75-95. | |||||
REF 21 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8420). | |||||
REF 22 | ClinicalTrials.gov (NCT00430300) Safety And Efficacy Of UK-432,097 In Chronic Obstructive Pulmonary Disease.. U.S. National Institutes of Health. | |||||
REF 23 | ClinicalTrials.gov (NCT04660812) An Open Label Study Evaluating the Efficacy and Safety of AB928 Based Treatment Combinations in Patients With Metastatic Colorectal Cancer.. U.S. National Institutes of Health. | |||||
REF 24 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5594). | |||||
REF 25 | ClinicalTrials.gov (NCT01279083) Safety and Efficacy Trial to Treat Open-Angle Glaucoma or Ocular Hypertension. U.S. National Institutes of Health. | |||||
REF 26 | ClinicalTrials.gov (NCT01410188) Safety/Efficacy Study: OPA-6566 Ophthalmic Solution in Subjects With Primary Open-Angle Glaucoma or Ocular Hypertension. U.S. National Institutes of Health. | |||||
REF 27 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 28 | ClinicalTrials.gov (NCT02253745) Safety, Tolerability, PK & Efficacy of V81444 in Volunteers With Attention Deficit/ Hyperactivity Disorder (ADHD). U.S. National Institutes of Health. | |||||
REF 29 | ClinicalTrials.gov (NCT03873883) First-in-Human Study of EOS100850 in Patients With Cancer. U.S. National Institutes of Health. | |||||
REF 30 | ClinicalTrials.gov (NCT01640990) A Study to Assess the Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of an Intravenous Infusion of GW328267X in Healthy Volunteers. U.S. National Institutes of Health. | |||||
REF 31 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005980) | |||||
REF 32 | ClinicalTrials.gov (NCT03786484) Study of PBF-999 in Solid Tumour Advanced Cancer. U.S. National Institutes of Health. | |||||
REF 33 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021875) | |||||
REF 34 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023039) | |||||
REF 35 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027391) | |||||
REF 36 | Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26. | |||||
REF 37 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000987) | |||||
REF 38 | Adenosine receptor antagonists intensify the benzodiazepine withdrawal signs in mice. Pharmacol Rep. 2006 Sep-Oct;58(5):643-51. | |||||
REF 39 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 40 | Coronary circulation responses to binodenoson, a selective adenosine A2A receptor agonist. Am J Cardiol. 2007 Jun 1;99(11):1507-12. | |||||
REF 41 | Tozadenant (SYN115) in patients with Parkinson's disease who have motor fluctuations on levodopa: a phase 2b, double-blind, randomised trial. Lancet Neurol. 2014 Aug;13(8):767-76. | |||||
REF 42 | Adenosine A1/A2a receptor agonist AMP-579 induces acute and delayed preconditioning against in vivo myocardial stunning. Am J Physiol Heart Circ Physiol. 2004 Dec;287(6):H2746-53. | |||||
REF 43 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. | |||||
REF 44 | 2-Amino-5-benzoyl-4-phenylthiazoles: Development of potent and selective adenosine A1 receptor antagonists. Bioorg Med Chem. 2010 Mar 15;18(6):2195-2203. | |||||
REF 45 | Structure of an agonist-bound human A2A adenosine receptor. Science. 2011 Apr 15;332(6027):322-7. | |||||
REF 46 | Effect of novel A2A adenosine receptor agonist ATL 313 on Clostridium difficile toxin A-induced murine ileal enteritis. Infect Immun. 2006 May;74(5):2606-12. | |||||
REF 47 | Clinical pipeline report, company report or official report of Acucela. | |||||
REF 48 | Adenosine A2A receptor antagonists in Parkinson's disease: progress in clinical trials from the newly approved istradefylline to drugs in early development and those already discontinued. CNS Drugs. 2014 May;28(5):455-74. | |||||
REF 49 | National Cancer Institute Drug Dictionary (drug name EOS100850). | |||||
REF 50 | ADENOSINE RECEPTORS AS TARGETS FOR THERAPEUTIC INTERVENTION IN ASTHMA AND CHRONIC OBSTRUCTIVE PULMONARY DISEASE | |||||
REF 51 | Photoisomerization of a potent and selective adenosine A2 antagonist, (E)-1,3-Dipropyl-8-(3,4-dimethoxystyryl)-7-methylxanthine. J Med Chem. 1993 Nov 12;36(23):3731-3. | |||||
REF 52 | Clinical pipeline report, company report or official report of Palobiofarma. | |||||
REF 53 | Design, radiosynthesis, and biodistribution of a new potent and selective ligand for in vivo imaging of the adenosine A(2A) receptor system using p... J Med Chem. 2000 Nov 16;43(23):4359-62. | |||||
REF 54 | Blockade of A2A adenosine receptors prevents basic fibroblast growth factor-induced reactive astrogliosis in rat striatal primary astrocytes. Glia. 2003 Aug;43(2):190-4. | |||||
REF 55 | Adenosine A2A receptor antagonists are potential antidepressants: evidence based on pharmacology and A2A receptor knockout mice. Br J Pharmacol. 2001 Sep;134(1):68-77. | |||||
REF 56 | Recent developments in adenosine receptor ligands and their potential as novel drugs. Biochim Biophys Acta. 2011 May;1808(5):1290-308. | |||||
REF 57 | The novel adenosine A2A antagonist Lu AA47070 reverses the motor and motivational effects produced by dopamine D2 receptor blockade. Pharmacol Biochem Behav. 2012 Jan;100(3):498-505. | |||||
REF 58 | Methanocarba analogues of purine nucleosides as potent and selective adenosine receptor agonists. J Med Chem. 2000 Jun 1;43(11):2196-203. | |||||
REF 59 | Novel amino acid derived natural products from the ascidian Atriolum robustum: identification and pharmacological characterization of a unique aden... J Med Chem. 2004 Apr 22;47(9):2243-55. | |||||
REF 60 | N-substituted adenosines as novel neuroprotective A(1) agonists with diminished hypotensive effects. J Med Chem. 1999 Sep 9;42(18):3463-77. | |||||
REF 61 | 2-Phenylpyrazolo[4,3-d]pyrimidin-7-one as a new scaffold to obtain potent and selective human A3 adenosine receptor antagonists: new insights into ... J Med Chem. 2009 Dec 10;52(23):7640-52. | |||||
REF 62 | 1H-imidazo[4,5-c]quinolin-4-amines: novel non-xanthine adenosine antagonists. J Med Chem. 1991 Mar;34(3):1202-6. | |||||
REF 63 | Structure-activity relationships of 9-alkyladenine and ribose-modified adenosine derivatives at rat A3 adenosine receptors. J Med Chem. 1995 May 12;38(10):1720-35. | |||||
REF 64 | Structure-based discovery of novel chemotypes for adenosine A(2A) receptor antagonists. J Med Chem. 2010 Feb 25;53(4):1799-809. | |||||
REF 65 | Dual inhibition of monoamine oxidase B and antagonism of the adenosine A(2A) receptor by (E,E)-8-(4-phenylbutadien-1-yl)caffeine analogues. Bioorg Med Chem. 2008 Sep 15;16(18):8676-84. | |||||
REF 66 | 8-Bromo-9-alkyl adenine derivatives as tools for developing new adenosine A2A and A2B receptors ligands. Bioorg Med Chem. 2009 Apr 1;17(7):2812-22. | |||||
REF 67 | Analogues of caffeine and theophylline: effect of structural alterations on affinity at adenosine receptors. J Med Chem. 1986 Jul;29(7):1305-8. | |||||
REF 68 | 1,3-Dialkyl-8-(p-sulfophenyl)xanthines: potent water-soluble antagonists for A1- and A2-adenosine receptors. J Med Chem. 1985 Apr;28(4):487-92. | |||||
REF 69 | Benzo[1,2-c:5,4-c']dipyrazoles: non-xanthine adenosine antagonists. J Med Chem. 1988 Oct;31(10):2034-9. | |||||
REF 70 | Preparation, properties, reactions, and adenosine receptor affinities of sulfophenylxanthine nitrophenyl esters: toward the development of sulfonic... J Med Chem. 2004 Feb 12;47(4):1031-43. | |||||
REF 71 | Thiazole and thiadiazole analogues as a novel class of adenosine receptor antagonists. J Med Chem. 2001 Mar 1;44(5):749-62. | |||||
REF 72 | N6-Cycloalkyl- and N6-bicycloalkyl-C5'(C2')-modified adenosine derivatives as high-affinity and selective agonists at the human A1 adenosine recept... J Med Chem. 2009 Apr 23;52(8):2393-406. | |||||
REF 73 | 2,6-disubstituted and 2,6,8-trisubstituted purines as adenosine receptor antagonists. J Med Chem. 2006 May 18;49(10):2861-7. | |||||
REF 74 | 2,6,8-trisubstituted 1-deazapurines as adenosine receptor antagonists. J Med Chem. 2007 Feb 22;50(4):828-34. | |||||
REF 75 | A new generation of adenosine receptor antagonists: from di- to trisubstituted aminopyrimidines. Bioorg Med Chem. 2008 Mar 15;16(6):2741-52. | |||||
REF 76 | Derivatives of 4-amino-6-hydroxy-2-mercaptopyrimidine as novel, potent, and selective A3 adenosine receptor antagonists. J Med Chem. 2008 Mar 27;51(6):1764-70. | |||||
REF 77 | Structure-activity relationships of 2,N(6),5'-substituted adenosine derivatives with potent activity at the A2B adenosine receptor. J Med Chem. 2007 Apr 19;50(8):1810-27. | |||||
REF 78 | Identification of novel, water-soluble, 2-amino-N-pyrimidin-4-yl acetamides as A2A receptor antagonists with in vivo efficacy. J Med Chem. 2008 Feb 14;51(3):400-6. | |||||
REF 79 | 2-(Benzimidazol-2-yl)quinoxalines: a novel class of selective antagonists at human A(1) and A(3) adenosine receptors designed by 3D database search... J Med Chem. 2005 Dec 29;48(26):8253-60. | |||||
REF 80 | N6-methoxy-2-alkynyladenosine derivatives as highly potent and selective ligands at the human A3 adenosine receptor. J Med Chem. 2007 Mar 22;50(6):1222-30. | |||||
REF 81 | Insights into binding modes of adenosine A(2B) antagonists with ligand-based and receptor-based methods. Eur J Med Chem. 2010 Aug;45(8):3459-71. | |||||
REF 82 | 2-Amino-6-furan-2-yl-4-substituted nicotinonitriles as A2A adenosine receptor antagonists. J Med Chem. 2008 Aug 14;51(15):4449-55. | |||||
REF 83 | Identification of non-furan containing A2A antagonists using database mining and molecular similarity approaches. Bioorg Med Chem Lett. 2006 Dec 1;16(23):5993-7. | |||||
REF 84 | Antagonists of the human adenosine A2A receptor. Part 3: Design and synthesis of pyrazolo[3,4-d]pyrimidines, pyrrolo[2,3-d]pyrimidines and 6-arylpu... Bioorg Med Chem Lett. 2008 May 1;18(9):2924-9. | |||||
REF 85 | Antagonists of the human adenosine A2A receptor. Part 2: Design and synthesis of 4-arylthieno[3,2-d]pyrimidine derivatives. Bioorg Med Chem Lett. 2008 May 1;18(9):2920-3. | |||||
REF 86 | New 2-arylpyrazolo[3,4-c]quinoline derivatives as potent and selective human A3 adenosine receptor antagonists. Synthesis, pharmacological evaluati... J Med Chem. 2007 Aug 23;50(17):4061-74. | |||||
REF 87 | 1,8-Naphthyridin-4-one derivatives as new ligands of A2A adenosine receptors. Bioorg Med Chem Lett. 2005 Oct 15;15(20):4604-10. | |||||
REF 88 | Potent and orally bioavailable 8-bicyclo[2.2.2]octylxanthines as adenosine A1 receptor antagonists. J Med Chem. 2006 Nov 30;49(24):7119-31. | |||||
REF 89 | Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97. | |||||
REF 90 | Antagonists of the human A(2A) adenosine receptor. 4. Design, synthesis, and preclinical evaluation of 7-aryltriazolo[4,5-d]pyrimidines. J Med Chem. 2009 Jan 8;52(1):33-47. | |||||
REF 91 | Synthesis of eudistomin D analogues and its effects on adenosine receptors. Bioorg Med Chem. 2008 Apr 1;16(7):3825-30. | |||||
REF 92 | Facile synthesis of fused 1,2,4-triazolo[1,5-c]pyrimidine derivatives as human adenosine A3 receptor ligands. Bioorg Med Chem Lett. 2004 May 17;14(10):2443-6. | |||||
REF 93 | 6-(2-Furanyl)-9H-purin-2-amine derivatives as A2A adenosine antagonists. Bioorg Med Chem Lett. 2005 Apr 15;15(8):2119-22. | |||||
REF 94 | Introduction of alkynyl chains on C-8 of adenosine led to very selective antagonists of the A(3) adenosine receptor. Bioorg Med Chem Lett. 2001 Jul 23;11(14):1931-4. | |||||
REF 95 | 2-n-Butyl-9-methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine and analogues as A2A adenosine receptor antagonists. Design, synthesis, and pharmacolog... J Med Chem. 2005 Nov 3;48(22):6887-96. | |||||
REF 96 | Effects of CGS 21680, a selective adenosine A2A receptor agonist, on allergic airways inflammation in the rat. Eur J Pharmacol. 2002 Mar 8;438(3):183-8. | |||||
REF 97 | Reversine and its 2-substituted adenine derivatives as potent and selective A3 adenosine receptor antagonists. J Med Chem. 2005 Jul 28;48(15):4910-8. | |||||
REF 98 | Discovery of FR166124, a novel water-soluble pyrazolo-[1,5-a]pyridine adenosine A1 receptor antagonist. Bioorg Med Chem Lett. 1999 Jul 19;9(14):1979-84. | |||||
REF 99 | Mutagenesis reveals structure-activity parallels between human A2A adenosine receptors and biogenic amine G protein-coupled receptors. J Med Chem. 1997 Aug 1;40(16):2588-95. | |||||
REF 100 | Synthesis and theoretical studies on energetics of novel N- and O- perfluoroalkyl triazole tagged thienopyrimidines--their potential as adenosine r... Eur J Med Chem. 2010 May;45(5):1739-45. | |||||
REF 101 | High selectivity of novel isoguanosine analogues for the adenosine A1 receptor. Bioorg. Med. Chem. Lett. 1(9):481-486 (1991). | |||||
REF 102 | Bioactive pyridoacridine alkaloids from the micronesian sponge Oceanapia sp. J Nat Prod. 1998 Feb;61(2):301-5. | |||||
REF 103 | 2,4,6-trisubstituted pyrimidines as a new class of selective adenosine A1 receptor antagonists. J Med Chem. 2004 Dec 16;47(26):6529-40. | |||||
REF 104 | Synthetic studies on selective adenosine A2A receptor antagonists: synthesis and structure-activity relationships of novel benzofuran derivatives. Bioorg Med Chem Lett. 2010 Feb 1;20(3):1090-3. | |||||
REF 105 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5610). | |||||
REF 106 | Discovery of N-(5,6-diarylpyridin-2-yl)amide derivatives as potent and selective A(2B) adenosine receptor antagonists. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1697-700. | |||||
REF 107 | Neuroprotective principles from Gastrodia elata. J Nat Prod. 2007 Apr;70(4):571-4. | |||||
REF 108 | N6-1,3-diphenylurea derivatives of 2-phenyl-9-benzyladenines and 8-azaadenines: synthesis and biological evaluation as allosteric modulators of A2A... Eur J Med Chem. 2008 Aug;43(8):1639-47. | |||||
REF 109 | (E)-1,3-dialkyl-7-methyl-8-(3,4,5-trimethoxystyryl)xanthines: potent and selective adenosine A2 antagonists. J Med Chem. 1992 Jun 12;35(12):2342-5. | |||||
REF 110 | Antagonists of the human adenosine A2A receptor. Part 1: Discovery and synthesis of thieno[3,2-d]pyrimidine-4-methanone derivatives. Bioorg Med Chem Lett. 2008 May 1;18(9):2916-9. | |||||
REF 111 | 1-alkyl-8-(piperazine-1-sulfonyl)phenylxanthines: development and characterization of adenosine A2B receptor antagonists and a new radioligand with... J Med Chem. 2009 Jul 9;52(13):3994-4006. | |||||
REF 112 | Design, synthesis, and biological evaluation of a second generation of pyrazolo[4,3-e]-1,2,4-triazolo[1,5-c]pyrimidines as potent and selective A2A... J Med Chem. 1998 Jun 4;41(12):2126-33. | |||||
REF 113 | 5'-Carbamoyl derivatives of 2'-C-methyl-purine nucleosides as selective A1 adenosine receptor agonists: affinity, efficacy, and selectivity for A1 ... Bioorg Med Chem. 2008 Jan 1;16(1):336-53. | |||||
REF 114 | Adenosine receptor agonists: synthesis and biological evaluation of 1-deaza analogues of adenosine derivatives. J Med Chem. 1988 Jun;31(6):1179-83. | |||||
REF 115 | Structure of the adenosine A(2A) receptor in complex with ZM241385 and the xanthines XAC and caffeine. Structure. 2011 Sep 7;19(9):1283-93. | |||||
REF 116 | Agonist-bound adenosine A2A receptor structures reveal common features of GPCR activation. Nature. 2011 May 18;474(7352):521-5. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.