Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T77365
(Former ID: TTDS00187)
|
|||||
Target Name |
Adenosine A2a receptor (ADORA2A)
|
|||||
Synonyms |
Adenosine receptor A2a; ADORA2; A2a Adenosine receptor; A(2A) adenosine receptor
|
|||||
Gene Name |
ADORA2A
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 3 Target-related Diseases | + | ||||
1 | Orthostatic hypotension [ICD-11: BA21] | |||||
2 | Parkinsonism [ICD-11: 8A00] | |||||
3 | Radionuclide imaging [ICD-11: N.A.] | |||||
Function |
The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Receptor for adenosine.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T77M4W |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 3 Approved Drugs | + | ||||
1 | Caffeine | Drug Info | Approved | Orthostatic hypotension | [2], [3] | |
2 | Istradefylline | Drug Info | Approved | Parkinson disease | [4] | |
3 | Regadenoson | Drug Info | Approved | Radionuclide imaging | [5], [6] | |
Clinical Trial Drug(s) | [+] 20 Clinical Trial Drugs | + | ||||
1 | Apadenoson | Drug Info | Phase 3 | Coronary artery disease | [7], [8] | |
2 | Binodenoson | Drug Info | Phase 3 | Hypertension | [9], [10] | |
3 | Tozadenant | Drug Info | Phase 3 | Parkinson disease | [11], [12] | |
4 | AMP-579 | Drug Info | Phase 2 | Hyperlipidaemia | [13] | |
5 | AZD4635 | Drug Info | Phase 2 | Prostate cancer | [14] | |
6 | BIIB014 | Drug Info | Phase 2 | Parkinson disease | [15], [16] | |
7 | Dexefaroxan | Drug Info | Phase 2 | Parkinson disease | [17] | |
8 | MRE-0094 | Drug Info | Phase 2 | Diabetic foot ulcer | [18] | |
9 | SCH 420814 | Drug Info | Phase 2 | Parkinson disease | [16], [19] | |
10 | Tonapofylline | Drug Info | Phase 2 | Acute and chronic heart failure | [20] | |
11 | UK-432097 | Drug Info | Phase 2 | Chronic obstructive pulmonary disease | [21], [22] | |
12 | AB928 | Drug Info | Phase 1/2 | Metastatic colorectal cancer | [23] | |
13 | ATL-313 | Drug Info | Phase 1/2 | Arteriosclerosis | [24], [25] | |
14 | OPA-6566 | Drug Info | Phase 1/2 | Glaucoma/ocular hypertension | [26] | |
15 | PBF509 | Drug Info | Phase 1/2 | Non-small-cell lung cancer | [27] | |
16 | V81444 | Drug Info | Phase 1/2 | Parkinson disease | [28] | |
17 | EOS100850 | Drug Info | Phase 1 | Solid tumour/cancer | [29] | |
18 | GW-328267 | Drug Info | Phase 1 | Allergic rhinitis | [30] | |
19 | KF-17837 | Drug Info | Phase 1 | Parkinson disease | [31] | |
20 | PBF-999 | Drug Info | Phase 1 | Solid tumour/cancer | [32] | |
Discontinued Drug(s) | [+] 5 Discontinued Drugs | + | ||||
1 | PF-1913539 | Drug Info | Discontinued in Phase 3 | Alzheimer disease | [33] | |
2 | BVT-115959 | Drug Info | Discontinued in Phase 2 | Pain | [34] | |
3 | Lu-AA47070 | Drug Info | Discontinued in Phase 1 | Parkinson disease | [35] | |
4 | T-62 | Drug Info | Discontinued in Phase 1 | Neuropathic pain | [36] | |
5 | METHYLTHIOADENOSINE | Drug Info | Terminated | Multiple sclerosis | [37] | |
Mode of Action | [+] 4 Modes of Action | + | ||||
Antagonist | [+] 13 Antagonist drugs | + | ||||
1 | Caffeine | Drug Info | [1], [38] | |||
2 | Tozadenant | Drug Info | [41] | |||
3 | AZD4635 | Drug Info | [27] | |||
4 | BIIB014 | Drug Info | [16] | |||
5 | SCH 420814 | Drug Info | [16] | |||
6 | AB928 | Drug Info | [27] | |||
7 | PBF509 | Drug Info | [27] | |||
8 | V81444 | Drug Info | [48] | |||
9 | EOS100850 | Drug Info | [49] | |||
10 | PBF-999 | Drug Info | [52] | |||
11 | PF-1913539 | Drug Info | [54], [55] | |||
12 | Lu-AA47070 | Drug Info | [57] | |||
13 | T-62 | Drug Info | [36] | |||
Modulator | [+] 5 Modulator drugs | + | ||||
1 | Istradefylline | Drug Info | [4] | |||
2 | Regadenoson | Drug Info | [39] | |||
3 | AMP-579 | Drug Info | [42] | |||
4 | GW-328267 | Drug Info | [50] | |||
5 | MSX-3 | Drug Info | [105] | |||
Agonist | [+] 9 Agonist drugs | + | ||||
1 | Apadenoson | Drug Info | [7] | |||
2 | Binodenoson | Drug Info | [40] | |||
3 | Dexefaroxan | Drug Info | [43] | |||
4 | MRE-0094 | Drug Info | [18] | |||
5 | UK-432097 | Drug Info | [45] | |||
6 | ATL-313 | Drug Info | [46] | |||
7 | OPA-6566 | Drug Info | [47] | |||
8 | BVT-115959 | Drug Info | [56] | |||
9 | CGS 21680 | Drug Info | [96] | |||
Inhibitor | [+] 225 Inhibitor drugs | + | ||||
1 | Tonapofylline | Drug Info | [44] | |||
2 | KF-17837 | Drug Info | [51] | |||
3 | SCH-442416 | Drug Info | [53] | |||
4 | ARISTEROMYCIN | Drug Info | [58] | |||
5 | METHYLTHIOADENOSINE | Drug Info | [59] | |||
6 | METRIFUDIL | Drug Info | [60] | |||
7 | ZM-241385 | Drug Info | [61] | |||
8 | (1H-Imidazo[4,5-c]quinolin-4-yl)-phenyl-amine HCl | Drug Info | [62] | |||
9 | (2R,3S)-3-(6-Amino-purin-9-yl)-nonan-2-ol | Drug Info | [63] | |||
10 | (3-amino-5-bromobenzofuran-2-yl)(phenyl)methanone | Drug Info | [64] | |||
11 | (E,E)-8-(4-Phenylbutadien-1-yl)caffeine | Drug Info | [65] | |||
12 | (E,E)-8-[4-(3-Bromophenyl)butadien-1-yl]caffeine | Drug Info | [65] | |||
13 | (E,E)-8-[4-(3-Chlorophenyl)butadien-1-yl]caffeine | Drug Info | [65] | |||
14 | (E,E)-8-[4-(3-Fluorophenyl)butadien-1-yl]caffeine | Drug Info | [65] | |||
15 | (S)-DHPA | Drug Info | [66] | |||
16 | (Z)-8-(3-chlorostyryl)caffeine | Drug Info | [65] | |||
17 | 1,3,7-Tripropyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
18 | 1,3,8-Trimethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [68] | |||
19 | 1,3-Diallyl-3,7-dihydro-purine-2,6-dione | Drug Info | [69] | |||
20 | 1,3-Diallyl-7-methyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
21 | 1,3-Dibenzyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
22 | 1,3-Diethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [69] | |||
23 | 1,3-Diisobutyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
24 | 1,3-Dipropyl-3,7-dihydro-purine-2,6-dione | Drug Info | [69] | |||
25 | 1,4-diaminoanthracene-9,10-dione | Drug Info | [64] | |||
26 | 1-Allyl-3,7-dimethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
27 | 1-amino-2,4-bis(phenylthio)anthracene-9,10-dione | Drug Info | [64] | |||
28 | 1-amino-2-phenoxyanthracene-9,10-dione | Drug Info | [64] | |||
29 | 1-amino-4-chloroanthracene-9,10-dione | Drug Info | [64] | |||
30 | 1-amino-4-methoxyanthracene-9,10-dione | Drug Info | [64] | |||
31 | 1-aminoanthracene-9,10-dione | Drug Info | [64] | |||
32 | 1-Butyl-8-phenyl-3,7-dihydro-purine-2,6-dione | Drug Info | [70] | |||
33 | 1-Ethyl-3-methyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
34 | 1-Methyl-8-phenyl-3,7-dihydro-purine-2,6-dione | Drug Info | [70] | |||
35 | 1-METHYLXANTHINE | Drug Info | [69] | |||
36 | 1-Phenyl-3-(4-pyridin-2-yl-thiazol-2-yl)-urea | Drug Info | [71] | |||
37 | 1H-Imidazo[4,5-c]quinolin-4-ylamine HCl | Drug Info | [62] | |||
38 | 2,5'-dichloro-5'-deoxy-N6-cyclopentyladenosine | Drug Info | [72] | |||
39 | 2,6,8-triphenyl-9H-purine | Drug Info | [73] | |||
40 | 2,6-diphenyl-1-deazapurine | Drug Info | [74] | |||
41 | 2,6-diphenyl-8-(1-ethylpropyl)-1-deazapurine | Drug Info | [74] | |||
42 | 2,6-diphenyl-8-ethyl-1-deazapurine | Drug Info | [74] | |||
43 | 2,6-diphenyl-8-methyl-1-deazapurine | Drug Info | [74] | |||
44 | 2,6-diphenyl-8-tButyl-1-deazapurine | Drug Info | [74] | |||
45 | 2,6-diphenyl-9H-purine | Drug Info | [73] | |||
46 | 2,6-Diphenyl-pyrimidin-4-ylamine | Drug Info | [75] | |||
47 | 2,6-dphenyl-8-propyl-1-deazapurine | Drug Info | [74] | |||
48 | 2-(1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [76] | |||
49 | 2-(2''-indolylethyloxy)adenosine | Drug Info | [77] | |||
50 | 2-(2-furyl)-6-(1H-pyrazol-1-yl)pyrimidin-4-amine | Drug Info | [78] | |||
51 | 2-(3''(5''-chloro-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
52 | 2-(3''(7''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
53 | 2-(3''-(4''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
54 | 2-(3''-(5''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
55 | 2-(3''-(5''-fluoro-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
56 | 2-(3''-(5''-hydroxyindolyl)ethyloxy)adenosine | Drug Info | [77] | |||
57 | 2-(3''-(5''-iodo-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
58 | 2-(3''-(5''-methoxy-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
59 | 2-(3''-(6''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
60 | 2-(3''-(6''-chloro-indolyl)ethyloxy)adenosine | Drug Info | [77] | |||
61 | 2-(3''-(benzoimidazole-1''-yl)ethyloxy)adenosine | Drug Info | [77] | |||
62 | 2-(3''-indolylethyloxy)adenosine | Drug Info | [77] | |||
63 | 2-(3''-pyrrolylethyloxy)adenosine | Drug Info | [77] | |||
64 | 2-(4-chlorophenyl)-6-phenyl-9H-purine | Drug Info | [73] | |||
65 | 2-(4-ethylthiobenzimidazol-2-yl)quinoxaline | Drug Info | [79] | |||
66 | 2-(4-hydroxypent-1-yl)-N6-methoxyadenosine | Drug Info | [80] | |||
67 | 2-(4-methyl-1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [76] | |||
68 | 2-(5-cyano-1-pent-1-ynyl)-N6-methoxyadenosine | Drug Info | [80] | |||
69 | 2-(6-amino-8-bromo-9H-purin-9-yl)ethanol | Drug Info | [81] | |||
70 | 2-(hex-1-ynyl)-N6-methoxyadenosine | Drug Info | [80] | |||
71 | 2-amino-3-(m-tolylamino)naphthalene-1,4-dione | Drug Info | [64] | |||
72 | 2-Amino-4,6-di-furan-2-yl-nicotinonitrile | Drug Info | [82] | |||
73 | 2-Amino-4,6-di-thiophen-2-yl-nicotinonitrile | Drug Info | [82] | |||
74 | 2-Amino-4,6-diphenyl-nicotinonitrile | Drug Info | [82] | |||
75 | 2-Amino-4,6-diphenyl-pyrimidin-5-carbonitrile | Drug Info | [75] | |||
76 | 2-Amino-4,6-diphenyl-pyrimidine | Drug Info | [75] | |||
77 | 2-Amino-4-furan-2-yl-6-phenyl-nicotinonitrile | Drug Info | [82] | |||
78 | 2-Amino-4-phenyl-6-thiophen-2-yl-nicotinonitrile | Drug Info | [82] | |||
79 | 2-Amino-6-furan-2-yl-4-phenyl-nicotinonitrile | Drug Info | [82] | |||
80 | 2-amino-6-phenyl-4-p-tolylnicotinonitrile | Drug Info | [83] | |||
81 | 2-Amino-6-phenyl-4-thiophen-2-yl-nicotinonitrile | Drug Info | [82] | |||
82 | 2-amino-N-benzyl-6-phenyl-9H-purine-9-carboxamide | Drug Info | [84] | |||
83 | 2-chloro-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [85] | |||
84 | 2-chloro-4-(thiophen-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [85] | |||
85 | 2-Cyclopentyl-1H-imidazo[4,5-c]quinolin-4-ylamine | Drug Info | [62] | |||
86 | 2-ethyl-4-(furan-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [85] | |||
87 | 2-ethyl-4-(furan-3-yl)thieno[3,2-d]pyrimidine | Drug Info | [85] | |||
88 | 2-ethyl-4-(pyridin-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [85] | |||
89 | 2-ethyl-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [85] | |||
90 | 2-ethyl-4-(thiophen-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [85] | |||
91 | 2-ethynyl-N6-methoxyadenosine | Drug Info | [80] | |||
92 | 2-m-tolyl-2H-pyrazolo[3,4-c]quinolin-4-amine | Drug Info | [86] | |||
93 | 2-p-tolyl-2H-pyrazolo[3,4-c]quinolin-4-amine | Drug Info | [86] | |||
94 | 2-Phenyl-1H-imidazo[4,5-c]quinolin-4-ylamine | Drug Info | [62] | |||
95 | 2-phenyl-2H-pyrazolo[3,4-c]quinolin-4-amine | Drug Info | [86] | |||
96 | 2-phenylpropoxyadenosine | Drug Info | [77] | |||
97 | 2-tolyl-6-phenyl-9H-purine | Drug Info | [73] | |||
98 | 2-[(4-acetylphenyl)ethynyl]-N6-methoxyadenosine | Drug Info | [80] | |||
99 | 2-[(4-fluorophenyl)ethynyl]-N6-methoxyadenosine | Drug Info | [80] | |||
100 | 3-Benzyl-7-methyl-[1,8]naphthyridin-4-ol | Drug Info | [87] | |||
101 | 3-Benzyl-7-methyl-[1,8]naphthyridine-4-thiol | Drug Info | [87] | |||
102 | 3-Isopropyl-1-methyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
103 | 3-noradamantyl-1,3-dipropylxanthine | Drug Info | [88] | |||
104 | 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [89] | |||
105 | 4-(ethylthio)-6-phenyl-1,3,5-triazin-2-amine | Drug Info | [83] | |||
106 | 4-(furan-2-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine | Drug Info | [90] | |||
107 | 4-(furan-2-yl)thieno[3,2-d]pyrimidin-2-amine | Drug Info | [84] | |||
108 | 4-(thiazol-2-yl)thieno[3,2-d]pyrimidin-2-amine | Drug Info | [85] | |||
109 | 4-Amino-2,6-diphenyl-pyrimidine-5-carbonitrile | Drug Info | [75] | |||
110 | 4-amino-2-p-tolylisoindoline-1,3-dione | Drug Info | [64] | |||
111 | 5,7-dibromo-9H-pyrido[3,4-b]indol-6-ol | Drug Info | [91] | |||
112 | 5,7-diphenyl-3H-imidazo[4,5-b]pyridin-2-ol | Drug Info | [74] | |||
113 | 5-Azido-6-benzyl-2-methyl-[1,8]naphthyridine | Drug Info | [87] | |||
114 | 5-Butyl-8-phenyl-3H-[1,2,4]triazolo[5,1-i]purine | Drug Info | [92] | |||
115 | 6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [90] | |||
116 | 6-Furan-2-yl-9-phenethyl-9H-purin-2-ylamine | Drug Info | [93] | |||
117 | 6-Furan-2-yl-9-phenyl-9H-purin-2-ylamine | Drug Info | [93] | |||
118 | 6-guanidino-2-(3''-indolylethyloxy)adenosine | Drug Info | [77] | |||
119 | 7-Allyl-1,3-dimethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
120 | 7-Allyl-1,3-dipropyl-3,7-dihydro-purine-2,6-dione | Drug Info | [67] | |||
121 | 7-Isopropyl-7H-adenine | Drug Info | [66] | |||
122 | 7-Propyl-7H-adenine | Drug Info | [66] | |||
123 | 8-Br-adenine | Drug Info | [66] | |||
124 | 8-Bromo-9-(2,3-dihydroxypropyl)-9H-adenine | Drug Info | [66] | |||
125 | 8-Bromo-9-(2-butyl)-9H-adenine | Drug Info | [66] | |||
126 | 8-Bromo-9-(2-hydroxypropyl)-9H-adenine | Drug Info | [66] | |||
127 | 8-Bromo-9-(3-hydroxypropyl)-9H-adenine | Drug Info | [66] | |||
128 | 8-Bromo-9-(but-3-enyl)-9H-adenine | Drug Info | [66] | |||
129 | 8-Bromo-9-(sec-butyl)-9H-adenine | Drug Info | [66] | |||
130 | 8-Bromo-9-cyclobutyl-9H-adenine | Drug Info | [66] | |||
131 | 8-Bromo-9-cyclohexyl-9H-adenine | Drug Info | [66] | |||
132 | 8-Bromo-9-cyclopentyl-9H-adenine | Drug Info | [66] | |||
133 | 8-Bromo-9-ethyl-9H-adenine | Drug Info | [66] | |||
134 | 8-bromo-9-isobutyl-9H-purin-6-amine | Drug Info | [81] | |||
135 | 8-Bromo-9-isopropyl-9H-adenine | Drug Info | [66] | |||
136 | 8-Bromo-9-methyl-9H-adenine | Drug Info | [66] | |||
137 | 8-Bromo-9-phenylethyl-9H-adenine | Drug Info | [66] | |||
138 | 8-Bromo-9-propyl-9H-adenine | Drug Info | [66] | |||
139 | 8-PHENYL THEOPHYLLINE | Drug Info | [62] | |||
140 | 8-Phenyl-1-propyl-3,7-dihydro-purine-2,6-dione | Drug Info | [70] | |||
141 | 8-propyl-2,6-diphenyl-9H-purine | Drug Info | [73] | |||
142 | 9-(2-Hydroxyethyl)-9H-adenine | Drug Info | [66] | |||
143 | 9-(2-Hydroxypropyl)-9H-adenine | Drug Info | [66] | |||
144 | 9-(3-aminobenzyl)-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [84] | |||
145 | 9-(3-Hydroxypropyl)-9H-adenine | Drug Info | [66] | |||
146 | 9-(3-nitrobenzyl)-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [84] | |||
147 | 9-(4-nitrobenzyl)-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [84] | |||
148 | 9-(sec-Butyl)-9H-adenine | Drug Info | [66] | |||
149 | 9-Allyl-8-bromo-9H-adenine | Drug Info | [66] | |||
150 | 9-benzyl-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [84] | |||
151 | 9-Benzyl-8-bromo-9H-adenine | Drug Info | [66] | |||
152 | 9-BENZYL-9H-ADENINE | Drug Info | [66] | |||
153 | 9-But-3-enyl-9H-adenine | Drug Info | [66] | |||
154 | 9-Butyl-9H-adenine | Drug Info | [66] | |||
155 | 9-Cyclobutyl-9H-adenine | Drug Info | [66] | |||
156 | 9-Cycloheptyl-9H-adenine | Drug Info | [66] | |||
157 | 9-Cyclopentyl-9H-adenine | Drug Info | [66] | |||
158 | 9-Cyclopropyl-9H-adenine | Drug Info | [66] | |||
159 | 9-Ethyl-8-phenylethynyl-9H-purin-6-ylamine | Drug Info | [94] | |||
160 | 9-Ethyl-9H-adenine | Drug Info | [66] | |||
161 | 9-Isopropyl-9H-adenine | Drug Info | [66] | |||
162 | 9-Methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine | Drug Info | [95] | |||
163 | 9-Methyl-9H-adenine | Drug Info | [66] | |||
164 | 9-Phenylethyl-9H-adenine | Drug Info | [66] | |||
165 | 9-Propyl-9H-adenine | Drug Info | [66] | |||
166 | Alloxazine | Drug Info | [95] | |||
167 | Cyclohexyl-(2-phenoxy-9H-purin-6-yl)-amine | Drug Info | [97] | |||
168 | Cyclohexyl-(2-phenylsulfanyl-9H-purin-6-yl)-amine | Drug Info | [97] | |||
169 | Ethyl 5-benzoyl-4-phenylthiazol-2-ylcarbamate | Drug Info | [44] | |||
170 | FR-166124 | Drug Info | [98] | |||
171 | Galangin | Drug Info | [99] | |||
172 | GNF-PF-2224 | Drug Info | [100] | |||
173 | GNF-PF-2700 | Drug Info | [81] | |||
174 | isobutylmethylxanthine | Drug Info | [67] | |||
175 | Isoguanosine | Drug Info | [101] | |||
176 | Kuanoniamine D | Drug Info | [102] | |||
177 | LUF-5417 | Drug Info | [44] | |||
178 | LUF-5433 | Drug Info | [44] | |||
179 | LUF-5437 | Drug Info | [71] | |||
180 | LUF-5767 | Drug Info | [103] | |||
181 | LUF-5956 | Drug Info | [73] | |||
182 | LUF-5957 | Drug Info | [73] | |||
183 | LUF-5962 | Drug Info | [73] | |||
184 | LUF-5978 | Drug Info | [74] | |||
185 | LUF-5980 | Drug Info | [74] | |||
186 | LUF-5981 | Drug Info | [74] | |||
187 | Methyl 7-methoxy-4-phenylbenzofuran-2-ylcarbamate | Drug Info | [104] | |||
188 | N*6*-Cyclohexyl-N*2*-phenyl-9H-purine-2,6-diamine | Drug Info | [97] | |||
189 | N-(2,6-diphenylpyrimidin-4-yl)-2-ethylbutyramide | Drug Info | [103] | |||
190 | N-(2,6-diphenylpyrimidin-4-yl)-3-methylbutyramide | Drug Info | [103] | |||
191 | N-(2,6-diphenylpyrimidin-4-yl)acetamide | Drug Info | [103] | |||
192 | N-(2,6-diphenylpyrimidin-4-yl)butyramide | Drug Info | [103] | |||
193 | N-(2,6-diphenylpyrimidin-4-yl)isobutyramide | Drug Info | [103] | |||
194 | N-(2,6-diphenylpyrimidin-4-yl)propionamide | Drug Info | [103] | |||
195 | N-(2-(furan-2-yl)-3,4'-bipyridin-6-yl)acetamide | Drug Info | [106] | |||
196 | N-(3-Phenyl-[1,2,4]thiadiazol-5-yl)-benzamide | Drug Info | [71] | |||
197 | N-(4,6-diphenylpyrimidin-2-yl)propionamide | Drug Info | [103] | |||
198 | N-(4-Pyridin-2-yl-thiazol-2-yl)-benzamide | Drug Info | [71] | |||
199 | N-(5-Benzoyl-4-phenylthiazol-2-yl)benzamide | Drug Info | [44] | |||
200 | N-(7-methoxy-4-phenylbenzofuran-2-yl)acetamide | Drug Info | [104] | |||
201 | N6-((+/-)-endo-norborn-2-yl)adenosine | Drug Info | [72] | |||
202 | N6-(4-hydroxybenzyl)adenine riboside | Drug Info | [107] | |||
203 | N6-CYCLOPENTYLADENOSINE | Drug Info | [44] | |||
204 | N6-methoxy-2-phenylethynyladenosine | Drug Info | [80] | |||
205 | N6-methoxy-2-[(2-pyridinyl)ethynyl]adenosine | Drug Info | [80] | |||
206 | N6-methoxy-2-[(3-pyridinyl)ethynyl]-adenosine | Drug Info | [80] | |||
207 | N6-methoxy-2-[(4-methoxyphenyl)ethynyl]adenosine | Drug Info | [80] | |||
208 | N6-methoxy-2-[(4-pentylphenyl)ethynyl]adenosine | Drug Info | [80] | |||
209 | N6-methoxy-2-[(4-pyridinyl)ethynyl]adenosine | Drug Info | [80] | |||
210 | N6-methoxy-2-[2-(trimethylsilyl)ethynyl]adenosine | Drug Info | [80] | |||
211 | N6-[(4-Amino)-phenyl]-9-benzyl-2-phenyladenine | Drug Info | [108] | |||
212 | N6-[(4-Nitro)-phenyl]-9-benzyl-2-phenyladenine | Drug Info | [108] | |||
213 | PD-115199 | Drug Info | [109] | |||
214 | Phenyl 7-methoxy-4-phenylbenzofuran-2-ylcarbamate | Drug Info | [104] | |||
215 | Phenyl(2-(trifluoromethyl)quinolin-4-yl)methanol | Drug Info | [110] | |||
216 | PSB-0788 | Drug Info | [111] | |||
217 | PSB-09120 | Drug Info | [111] | |||
218 | PSB-601 | Drug Info | [111] | |||
219 | R-N6-(phenylisopropyl)adenosine | Drug Info | [77] | |||
220 | SB-298 | Drug Info | [111] | |||
221 | SCH-63390 | Drug Info | [112] | |||
222 | ST-1535 | Drug Info | [82] | |||
223 | [3H]CCPA | Drug Info | [113] | |||
224 | [3H]NECA | Drug Info | [114] | |||
225 | [3H]OSIP339391 | Drug Info | [81] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-interacting Proteins |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 7 KEGG Pathways | + | ||||
1 | Rap1 signaling pathway | |||||
2 | Calcium signaling pathway | |||||
3 | cAMP signaling pathway | |||||
4 | Neuroactive ligand-receptor interaction | |||||
5 | Vascular smooth muscle contraction | |||||
6 | Parkinson's disease | |||||
7 | Alcoholism | |||||
Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
1 | Intracellular Signalling Through Adenosine Receptor A2a and Adenosine | |||||
PID Pathway | [+] 1 PID Pathways | + | ||||
1 | HIF-2-alpha transcription factor network | |||||
Reactome | [+] 4 Reactome Pathways | + | ||||
1 | NGF-independant TRKA activation | |||||
2 | Adenosine P1 receptors | |||||
3 | G alpha (s) signalling events | |||||
4 | Surfactant metabolism | |||||
WikiPathways | [+] 7 WikiPathways | + | ||||
1 | Nucleotide GPCRs | |||||
2 | Monoamine Transport | |||||
3 | GPCRs, Class A Rhodopsin-like | |||||
4 | NGF signalling via TRKA from the plasma membrane | |||||
5 | GPCR ligand binding | |||||
6 | GPCR downstream signaling | |||||
7 | GPCRs, Other |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation | ||||||
Target QSAR Model |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Caffeine as a psychomotor stimulant: mechanism of action. Cell Mol Life Sci. 2004 Apr;61(7-8):857-72. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 407). | |||||
REF 3 | Fatigue: an overview. Am Fam Physician. 2008 Nov 15;78(10):1173-9. | |||||
REF 4 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019 | |||||
REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5596). | |||||
REF 6 | 2008 FDA drug approvals. Nat Rev Drug Discov. 2009 Feb;8(2):93-6. | |||||
REF 7 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3290). | |||||
REF 8 | ClinicalTrials.gov (NCT00990327) Study of the Safety and Efficacy of Apadenoson for Detection of Myocardial Perfusion Defects Using SPECT MPI. U.S. National Institutes of Health. | |||||
REF 9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5595). | |||||
REF 10 | ClinicalTrials.gov (NCT00944970) Efficacy and Safety Study of Binodenoson in Assessing Cardiac Ischemia. U.S. National Institutes of Health. | |||||
REF 11 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5611). | |||||
REF 12 | ClinicalTrials.gov (NCT02453386) Safety and Efficacy Study of Tozadenant to Treat End of Dose Wearing Off in Parkinson's Patients Using Levodopa. | |||||
REF 13 | Recent developments in adenosine receptor ligands and their potential as novel drugs. Biochim Biophys Acta. 2011 May; 1808(5): 1290-1308. | |||||
REF 14 | ClinicalTrials.gov (NCT04089553) An Open-label, Phase II Study of AZD4635 in Patients With Prostate Cancer. U.S. National Institutes of Health. | |||||
REF 15 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5612). | |||||
REF 16 | Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54. | |||||
REF 17 | Effects of the alpha 2-adrenoreceptor antagonist dexefaroxan on neurogenesis in the olfactory bulb of the adult rat in vivo: selective protection against neuronal death. Neuroscience. 2003;117(2):281-91. | |||||
REF 18 | Emerging drugs for diabetic foot ulcers. Expert Opin Emerg Drugs. 2006 Nov;11(4):709-24. | |||||
REF 19 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5614). | |||||
REF 20 | Emerging drugs for acute and chronic heart failure: current and future developments. Expert Opin Emerg Drugs. 2007 Mar;12(1):75-95. | |||||
REF 21 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8420). | |||||
REF 22 | ClinicalTrials.gov (NCT00430300) Safety And Efficacy Of UK-432,097 In Chronic Obstructive Pulmonary Disease.. U.S. National Institutes of Health. | |||||
REF 23 | ClinicalTrials.gov (NCT04660812) An Open Label Study Evaluating the Efficacy and Safety of AB928 Based Treatment Combinations in Patients With Metastatic Colorectal Cancer.. U.S. National Institutes of Health. | |||||
REF 24 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5594). | |||||
REF 25 | ClinicalTrials.gov (NCT01279083) Safety and Efficacy Trial to Treat Open-Angle Glaucoma or Ocular Hypertension. U.S. National Institutes of Health. | |||||
REF 26 | ClinicalTrials.gov (NCT01410188) Safety/Efficacy Study: OPA-6566 Ophthalmic Solution in Subjects With Primary Open-Angle Glaucoma or Ocular Hypertension. U.S. National Institutes of Health. | |||||
REF 27 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 28 | ClinicalTrials.gov (NCT02253745) Safety, Tolerability, PK & Efficacy of V81444 in Volunteers With Attention Deficit/ Hyperactivity Disorder (ADHD). U.S. National Institutes of Health. | |||||
REF 29 | ClinicalTrials.gov (NCT03873883) First-in-Human Study of EOS100850 in Patients With Cancer. U.S. National Institutes of Health. | |||||
REF 30 | ClinicalTrials.gov (NCT01640990) A Study to Assess the Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of an Intravenous Infusion of GW328267X in Healthy Volunteers. U.S. National Institutes of Health. | |||||
REF 31 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005980) | |||||
REF 32 | ClinicalTrials.gov (NCT03786484) Study of PBF-999 in Solid Tumour Advanced Cancer. U.S. National Institutes of Health. | |||||
REF 33 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021875) | |||||
REF 34 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023039) | |||||
REF 35 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027391) | |||||
REF 36 | Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26. | |||||
REF 37 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000987) | |||||
REF 38 | Adenosine receptor antagonists intensify the benzodiazepine withdrawal signs in mice. Pharmacol Rep. 2006 Sep-Oct;58(5):643-51. | |||||
REF 39 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 40 | Coronary circulation responses to binodenoson, a selective adenosine A2A receptor agonist. Am J Cardiol. 2007 Jun 1;99(11):1507-12. | |||||
REF 41 | Tozadenant (SYN115) in patients with Parkinson's disease who have motor fluctuations on levodopa: a phase 2b, double-blind, randomised trial. Lancet Neurol. 2014 Aug;13(8):767-76. | |||||
REF 42 | Adenosine A1/A2a receptor agonist AMP-579 induces acute and delayed preconditioning against in vivo myocardial stunning. Am J Physiol Heart Circ Physiol. 2004 Dec;287(6):H2746-53. | |||||
REF 43 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. | |||||
REF 44 | 2-Amino-5-benzoyl-4-phenylthiazoles: Development of potent and selective adenosine A1 receptor antagonists. Bioorg Med Chem. 2010 Mar 15;18(6):2195-2203. | |||||
REF 45 | Structure of an agonist-bound human A2A adenosine receptor. Science. 2011 Apr 15;332(6027):322-7. | |||||
REF 46 | Effect of novel A2A adenosine receptor agonist ATL 313 on Clostridium difficile toxin A-induced murine ileal enteritis. Infect Immun. 2006 May;74(5):2606-12. | |||||
REF 47 | Clinical pipeline report, company report or official report of Acucela. | |||||
REF 48 | Adenosine A2A receptor antagonists in Parkinson's disease: progress in clinical trials from the newly approved istradefylline to drugs in early development and those already discontinued. CNS Drugs. 2014 May;28(5):455-74. | |||||
REF 49 | National Cancer Institute Drug Dictionary (drug name EOS100850). | |||||
REF 50 | ADENOSINE RECEPTORS AS TARGETS FOR THERAPEUTIC INTERVENTION IN ASTHMA AND CHRONIC OBSTRUCTIVE PULMONARY DISEASE | |||||
REF 51 | Photoisomerization of a potent and selective adenosine A2 antagonist, (E)-1,3-Dipropyl-8-(3,4-dimethoxystyryl)-7-methylxanthine. J Med Chem. 1993 Nov 12;36(23):3731-3. | |||||
REF 52 | Clinical pipeline report, company report or official report of Palobiofarma. | |||||
REF 53 | Design, radiosynthesis, and biodistribution of a new potent and selective ligand for in vivo imaging of the adenosine A(2A) receptor system using p... J Med Chem. 2000 Nov 16;43(23):4359-62. | |||||
REF 54 | Blockade of A2A adenosine receptors prevents basic fibroblast growth factor-induced reactive astrogliosis in rat striatal primary astrocytes. Glia. 2003 Aug;43(2):190-4. | |||||
REF 55 | Adenosine A2A receptor antagonists are potential antidepressants: evidence based on pharmacology and A2A receptor knockout mice. Br J Pharmacol. 2001 Sep;134(1):68-77. | |||||
REF 56 | Recent developments in adenosine receptor ligands and their potential as novel drugs. Biochim Biophys Acta. 2011 May;1808(5):1290-308. | |||||
REF 57 | The novel adenosine A2A antagonist Lu AA47070 reverses the motor and motivational effects produced by dopamine D2 receptor blockade. Pharmacol Biochem Behav. 2012 Jan;100(3):498-505. | |||||
REF 58 | Methanocarba analogues of purine nucleosides as potent and selective adenosine receptor agonists. J Med Chem. 2000 Jun 1;43(11):2196-203. | |||||
REF 59 | Novel amino acid derived natural products from the ascidian Atriolum robustum: identification and pharmacological characterization of a unique aden... J Med Chem. 2004 Apr 22;47(9):2243-55. | |||||
REF 60 | N-substituted adenosines as novel neuroprotective A(1) agonists with diminished hypotensive effects. J Med Chem. 1999 Sep 9;42(18):3463-77. | |||||
REF 61 | 2-Phenylpyrazolo[4,3-d]pyrimidin-7-one as a new scaffold to obtain potent and selective human A3 adenosine receptor antagonists: new insights into ... J Med Chem. 2009 Dec 10;52(23):7640-52. | |||||
REF 62 | 1H-imidazo[4,5-c]quinolin-4-amines: novel non-xanthine adenosine antagonists. J Med Chem. 1991 Mar;34(3):1202-6. | |||||
REF 63 | Structure-activity relationships of 9-alkyladenine and ribose-modified adenosine derivatives at rat A3 adenosine receptors. J Med Chem. 1995 May 12;38(10):1720-35. | |||||
REF 64 | Structure-based discovery of novel chemotypes for adenosine A(2A) receptor antagonists. J Med Chem. 2010 Feb 25;53(4):1799-809. | |||||
REF 65 | Dual inhibition of monoamine oxidase B and antagonism of the adenosine A(2A) receptor by (E,E)-8-(4-phenylbutadien-1-yl)caffeine analogues. Bioorg Med Chem. 2008 Sep 15;16(18):8676-84. | |||||
REF 66 | 8-Bromo-9-alkyl adenine derivatives as tools for developing new adenosine A2A and A2B receptors ligands. Bioorg Med Chem. 2009 Apr 1;17(7):2812-22. | |||||
REF 67 | Analogues of caffeine and theophylline: effect of structural alterations on affinity at adenosine receptors. J Med Chem. 1986 Jul;29(7):1305-8. | |||||
REF 68 | 1,3-Dialkyl-8-(p-sulfophenyl)xanthines: potent water-soluble antagonists for A1- and A2-adenosine receptors. J Med Chem. 1985 Apr;28(4):487-92. | |||||
REF 69 | Benzo[1,2-c:5,4-c']dipyrazoles: non-xanthine adenosine antagonists. J Med Chem. 1988 Oct;31(10):2034-9. | |||||
REF 70 | Preparation, properties, reactions, and adenosine receptor affinities of sulfophenylxanthine nitrophenyl esters: toward the development of sulfonic... J Med Chem. 2004 Feb 12;47(4):1031-43. | |||||
REF 71 | Thiazole and thiadiazole analogues as a novel class of adenosine receptor antagonists. J Med Chem. 2001 Mar 1;44(5):749-62. | |||||
REF 72 | N6-Cycloalkyl- and N6-bicycloalkyl-C5'(C2')-modified adenosine derivatives as high-affinity and selective agonists at the human A1 adenosine recept... J Med Chem. 2009 Apr 23;52(8):2393-406. | |||||
REF 73 | 2,6-disubstituted and 2,6,8-trisubstituted purines as adenosine receptor antagonists. J Med Chem. 2006 May 18;49(10):2861-7. | |||||
REF 74 | 2,6,8-trisubstituted 1-deazapurines as adenosine receptor antagonists. J Med Chem. 2007 Feb 22;50(4):828-34. | |||||
REF 75 | A new generation of adenosine receptor antagonists: from di- to trisubstituted aminopyrimidines. Bioorg Med Chem. 2008 Mar 15;16(6):2741-52. | |||||
REF 76 | Derivatives of 4-amino-6-hydroxy-2-mercaptopyrimidine as novel, potent, and selective A3 adenosine receptor antagonists. J Med Chem. 2008 Mar 27;51(6):1764-70. | |||||
REF 77 | Structure-activity relationships of 2,N(6),5'-substituted adenosine derivatives with potent activity at the A2B adenosine receptor. J Med Chem. 2007 Apr 19;50(8):1810-27. | |||||
REF 78 | Identification of novel, water-soluble, 2-amino-N-pyrimidin-4-yl acetamides as A2A receptor antagonists with in vivo efficacy. J Med Chem. 2008 Feb 14;51(3):400-6. | |||||
REF 79 | 2-(Benzimidazol-2-yl)quinoxalines: a novel class of selective antagonists at human A(1) and A(3) adenosine receptors designed by 3D database search... J Med Chem. 2005 Dec 29;48(26):8253-60. | |||||
REF 80 | N6-methoxy-2-alkynyladenosine derivatives as highly potent and selective ligands at the human A3 adenosine receptor. J Med Chem. 2007 Mar 22;50(6):1222-30. | |||||
REF 81 | Insights into binding modes of adenosine A(2B) antagonists with ligand-based and receptor-based methods. Eur J Med Chem. 2010 Aug;45(8):3459-71. | |||||
REF 82 | 2-Amino-6-furan-2-yl-4-substituted nicotinonitriles as A2A adenosine receptor antagonists. J Med Chem. 2008 Aug 14;51(15):4449-55. | |||||
REF 83 | Identification of non-furan containing A2A antagonists using database mining and molecular similarity approaches. Bioorg Med Chem Lett. 2006 Dec 1;16(23):5993-7. | |||||
REF 84 | Antagonists of the human adenosine A2A receptor. Part 3: Design and synthesis of pyrazolo[3,4-d]pyrimidines, pyrrolo[2,3-d]pyrimidines and 6-arylpu... Bioorg Med Chem Lett. 2008 May 1;18(9):2924-9. | |||||
REF 85 | Antagonists of the human adenosine A2A receptor. Part 2: Design and synthesis of 4-arylthieno[3,2-d]pyrimidine derivatives. Bioorg Med Chem Lett. 2008 May 1;18(9):2920-3. | |||||
REF 86 | New 2-arylpyrazolo[3,4-c]quinoline derivatives as potent and selective human A3 adenosine receptor antagonists. Synthesis, pharmacological evaluati... J Med Chem. 2007 Aug 23;50(17):4061-74. | |||||
REF 87 | 1,8-Naphthyridin-4-one derivatives as new ligands of A2A adenosine receptors. Bioorg Med Chem Lett. 2005 Oct 15;15(20):4604-10. | |||||
REF 88 | Potent and orally bioavailable 8-bicyclo[2.2.2]octylxanthines as adenosine A1 receptor antagonists. J Med Chem. 2006 Nov 30;49(24):7119-31. | |||||
REF 89 | Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97. | |||||
REF 90 | Antagonists of the human A(2A) adenosine receptor. 4. Design, synthesis, and preclinical evaluation of 7-aryltriazolo[4,5-d]pyrimidines. J Med Chem. 2009 Jan 8;52(1):33-47. | |||||
REF 91 | Synthesis of eudistomin D analogues and its effects on adenosine receptors. Bioorg Med Chem. 2008 Apr 1;16(7):3825-30. | |||||
REF 92 | Facile synthesis of fused 1,2,4-triazolo[1,5-c]pyrimidine derivatives as human adenosine A3 receptor ligands. Bioorg Med Chem Lett. 2004 May 17;14(10):2443-6. | |||||
REF 93 | 6-(2-Furanyl)-9H-purin-2-amine derivatives as A2A adenosine antagonists. Bioorg Med Chem Lett. 2005 Apr 15;15(8):2119-22. | |||||
REF 94 | Introduction of alkynyl chains on C-8 of adenosine led to very selective antagonists of the A(3) adenosine receptor. Bioorg Med Chem Lett. 2001 Jul 23;11(14):1931-4. | |||||
REF 95 | 2-n-Butyl-9-methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine and analogues as A2A adenosine receptor antagonists. Design, synthesis, and pharmacolog... J Med Chem. 2005 Nov 3;48(22):6887-96. | |||||
REF 96 | Effects of CGS 21680, a selective adenosine A2A receptor agonist, on allergic airways inflammation in the rat. Eur J Pharmacol. 2002 Mar 8;438(3):183-8. | |||||
REF 97 | Reversine and its 2-substituted adenine derivatives as potent and selective A3 adenosine receptor antagonists. J Med Chem. 2005 Jul 28;48(15):4910-8. | |||||
REF 98 | Discovery of FR166124, a novel water-soluble pyrazolo-[1,5-a]pyridine adenosine A1 receptor antagonist. Bioorg Med Chem Lett. 1999 Jul 19;9(14):1979-84. | |||||
REF 99 | Mutagenesis reveals structure-activity parallels between human A2A adenosine receptors and biogenic amine G protein-coupled receptors. J Med Chem. 1997 Aug 1;40(16):2588-95. | |||||
REF 100 | Synthesis and theoretical studies on energetics of novel N- and O- perfluoroalkyl triazole tagged thienopyrimidines--their potential as adenosine r... Eur J Med Chem. 2010 May;45(5):1739-45. | |||||
REF 101 | High selectivity of novel isoguanosine analogues for the adenosine A1 receptor. Bioorg. Med. Chem. Lett. 1(9):481-486 (1991). | |||||
REF 102 | Bioactive pyridoacridine alkaloids from the micronesian sponge Oceanapia sp. J Nat Prod. 1998 Feb;61(2):301-5. | |||||
REF 103 | 2,4,6-trisubstituted pyrimidines as a new class of selective adenosine A1 receptor antagonists. J Med Chem. 2004 Dec 16;47(26):6529-40. | |||||
REF 104 | Synthetic studies on selective adenosine A2A receptor antagonists: synthesis and structure-activity relationships of novel benzofuran derivatives. Bioorg Med Chem Lett. 2010 Feb 1;20(3):1090-3. | |||||
REF 105 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5610). | |||||
REF 106 | Discovery of N-(5,6-diarylpyridin-2-yl)amide derivatives as potent and selective A(2B) adenosine receptor antagonists. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1697-700. | |||||
REF 107 | Neuroprotective principles from Gastrodia elata. J Nat Prod. 2007 Apr;70(4):571-4. | |||||
REF 108 | N6-1,3-diphenylurea derivatives of 2-phenyl-9-benzyladenines and 8-azaadenines: synthesis and biological evaluation as allosteric modulators of A2A... Eur J Med Chem. 2008 Aug;43(8):1639-47. | |||||
REF 109 | (E)-1,3-dialkyl-7-methyl-8-(3,4,5-trimethoxystyryl)xanthines: potent and selective adenosine A2 antagonists. J Med Chem. 1992 Jun 12;35(12):2342-5. | |||||
REF 110 | Antagonists of the human adenosine A2A receptor. Part 1: Discovery and synthesis of thieno[3,2-d]pyrimidine-4-methanone derivatives. Bioorg Med Chem Lett. 2008 May 1;18(9):2916-9. | |||||
REF 111 | 1-alkyl-8-(piperazine-1-sulfonyl)phenylxanthines: development and characterization of adenosine A2B receptor antagonists and a new radioligand with... J Med Chem. 2009 Jul 9;52(13):3994-4006. | |||||
REF 112 | Design, synthesis, and biological evaluation of a second generation of pyrazolo[4,3-e]-1,2,4-triazolo[1,5-c]pyrimidines as potent and selective A2A... J Med Chem. 1998 Jun 4;41(12):2126-33. | |||||
REF 113 | 5'-Carbamoyl derivatives of 2'-C-methyl-purine nucleosides as selective A1 adenosine receptor agonists: affinity, efficacy, and selectivity for A1 ... Bioorg Med Chem. 2008 Jan 1;16(1):336-53. | |||||
REF 114 | Adenosine receptor agonists: synthesis and biological evaluation of 1-deaza analogues of adenosine derivatives. J Med Chem. 1988 Jun;31(6):1179-83. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.