Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T02551
(Former ID: TTDS00013)
|
|||||
Target Name |
Dopamine D3 receptor (D3R)
|
|||||
Synonyms |
D(3) dopamine receptor
|
|||||
Gene Name |
DRD3
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Bipolar disorder [ICD-11: 6A60] | |||||
2 | Parkinsonism [ICD-11: 8A00] | |||||
Function |
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Promotes cell proliferation.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
ADReCS ID | BADD_A04234 | |||||
HIT2.0 ID | T43Y5O |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 3 Approved Drugs | + | ||||
1 | Cariprazine | Drug Info | Approved | Bipolar disorder | [1], [2] | |
2 | Pramipexole | Drug Info | Approved | Parkinson disease | [3], [4] | |
3 | Ropinirole | Drug Info | Approved | Parkinson disease | [5], [6] | |
Clinical Trial Drug(s) | [+] 8 Clinical Trial Drugs | + | ||||
1 | CM-2395 | Drug Info | Phase 3 | Schizophrenia | [7] | |
2 | P2B-001 | Drug Info | Phase 3 | Parkinson disease | [8] | |
3 | GSK598809 | Drug Info | Phase 2 | Drug abuse | [9] | |
4 | ONC201 | Drug Info | Phase 2 | Glioma | [8], [10] | |
5 | RP5063 | Drug Info | Phase 2 | Schizophrenia | [11] | |
6 | TAK-906 | Drug Info | Phase 2 | Diabetic gastroparesis | [12] | |
7 | GSK618334 | Drug Info | Phase 1 | Drug abuse | [13] | |
8 | Pfizer 10 | Drug Info | Phase 1 | Female sexual arousal dysfunction | [14] | |
Discontinued Drug(s) | [+] 15 Discontinued Drugs | + | ||||
1 | Quinelorane | Drug Info | Discontinued in Phase 3 | Male sexual disorder | [15], [16] | |
2 | A-437203 | Drug Info | Discontinued in Phase 2 | Psychotic disorder | [17] | |
3 | BP-897 | Drug Info | Discontinued in Phase 2 | Cocaine addiction | [18], [19] | |
4 | AVE-5997EF | Drug Info | Discontinued in Phase 1 | Psychotic disorder | [20] | |
5 | S-33138 | Drug Info | Discontinued in Phase 1 | Psychotic disorder | [21] | |
6 | AS-8112 | Drug Info | Terminated | Vomiting | [27] | |
7 | BP4.879a | Drug Info | Terminated | Schizophrenia | [23] | |
8 | BTS-79018 | Drug Info | Terminated | Schizophrenia | [23] | |
9 | Dianicline+rimonabant | Drug Info | Terminated | Tobacco dependence | [28] | |
10 | E-2040 | Drug Info | Terminated | Schizophrenia | [29] | |
11 | PNU-177864 | Drug Info | Terminated | Schizophrenia | [23] | |
12 | PNU-96391A | Drug Info | Terminated | Substance use disorder | [30] | |
13 | RGH-1756 | Drug Info | Terminated | Schizophrenia | [23] | |
14 | SB-277011 | Drug Info | Terminated | Schizophrenia | [23], [31] | |
15 | YM-43611 | Drug Info | Terminated | Psychotic disorder | [32] | |
Preclinical Drug(s) | [+] 7 Preclinical Drugs | + | ||||
1 | F-15063 | Drug Info | Preclinical | Schizophrenia | [22] | |
2 | PD-157533 | Drug Info | Preclinical | Schizophrenia | [23] | |
3 | PD-157695 | Drug Info | Preclinical | Schizophrenia | [23] | |
4 | PD-158771 | Drug Info | Preclinical | Schizophrenia | [23] | |
5 | S-33084 | Drug Info | Preclinical | Psychotic disorder | [24], [25] | |
6 | S32504 | Drug Info | Preclinical | Parkinson disease | [26] | |
7 | U-99194A | Drug Info | Preclinical | Schizophrenia | [23] | |
Mode of Action | [+] 8 Modes of Action | + | ||||
Modulator | [+] 13 Modulator drugs | + | ||||
1 | Cariprazine | Drug Info | [1] | |||
2 | Pramipexole | Drug Info | [33] | |||
3 | Ropinirole | Drug Info | [33] | |||
4 | Quinelorane | Drug Info | [40] | |||
5 | A-437203 | Drug Info | [41] | |||
6 | BP-897 | Drug Info | [42] | |||
7 | F-15063 | Drug Info | [46] | |||
8 | S-33084 | Drug Info | [47] | |||
9 | S32504 | Drug Info | [26] | |||
10 | E-2040 | Drug Info | [50] | |||
11 | PNU-96391A | Drug Info | [30] | |||
12 | YM-43611 | Drug Info | [52] | |||
13 | PD-152255 | Drug Info | [91] | |||
Agonist | [+] 8 Agonist drugs | + | ||||
1 | CM-2395 | Drug Info | [34] | |||
2 | Pfizer 10 | Drug Info | [14] | |||
3 | 7-trans-OH-PIPAT | Drug Info | [73] | |||
4 | N-propylnorapomorphine | Drug Info | [86] | |||
5 | PD 128907 | Drug Info | [89], [90] | |||
6 | PF-592379 | Drug Info | [92] | |||
7 | piribedil | Drug Info | [94] | |||
8 | [3H]7-OH-DPAT | Drug Info | [78], [101], [102] | |||
Inhibitor | [+] 76 Inhibitor drugs | + | ||||
1 | P2B-001 | Drug Info | [35] | |||
2 | TAK-906 | Drug Info | [38] | |||
3 | MAZAPERTINE | Drug Info | [43] | |||
4 | GR-218231 | Drug Info | [51] | |||
5 | (+)-BUTACLAMOL | Drug Info | [54] | |||
6 | (+/-)-nantenine | Drug Info | [56] | |||
7 | (-)-3-(1-Propyl-piperidin-3-yl)-benzonitrile | Drug Info | [57] | |||
8 | (2-Benzyl-phenyl)-(2-pyrrolidin-1-yl-ethyl)-amine | Drug Info | [58] | |||
9 | (4-Dipropylamino-cyclohexylidene)-acetonitrile | Drug Info | [59] | |||
10 | (4-Ethynyl-cyclohex-3-enyl)-dipropyl-amine | Drug Info | [60] | |||
11 | (4-Phenylethynyl-cyclohex-3-enyl)-dipropyl-amine | Drug Info | [59] | |||
12 | (R)-(-)-2-Methyl-apomorphine hydrochloride | Drug Info | [61] | |||
13 | (R)-(-)-2-Phenyl-apomorphine hydrochloride | Drug Info | [61] | |||
14 | (R)-2-(Benzylamino-methyl)-chroman-7-ol | Drug Info | [62] | |||
15 | 1-(4-(1H-pyrazol-1-yl)benzyl)-4-phenylpiperazine | Drug Info | [63] | |||
16 | 1-(4-(4-phenyl-1-piperazinyl)butyl)indolin-2-one | Drug Info | [64] | |||
17 | 1-Benzyl-4-(2-ethynyl-pyrrol-1-yl)-piperidine | Drug Info | [65] | |||
18 | 1-Benzyl-4-(2-iodo-pyrrol-1-yl)-piperidine | Drug Info | [65] | |||
19 | 1-Benzyl-4-(2-oxazol-5-yl-pyrrol-1-yl)-piperidine | Drug Info | [65] | |||
20 | 1-Benzyl-4-(3-oxazol-5-yl-pyrrol-1-yl)-piperidine | Drug Info | [65] | |||
21 | 1-Benzyl-4-pyrrol-1-yl-piperidine | Drug Info | [65] | |||
22 | 1-Dibenzo[b,f]oxepin-10-yl-4-methyl-piperazine | Drug Info | [66] | |||
23 | 1-Propyl-3-(3-trifluoromethyl-phenyl)-pyrrolidine | Drug Info | [67] | |||
24 | 1-[2-(2-Benzyl-phenoxy)-ethyl]-piperidine | Drug Info | [58] | |||
25 | 1-[2-(2-Benzyl-phenoxy)-ethyl]-pyrrolidine | Drug Info | [58] | |||
26 | 1-[3-(2-Benzyl-phenoxy)-propyl]-pyrrolidine | Drug Info | [58] | |||
27 | 2-(4-Dipropylamino-cyclohexylidene)-malononitrile | Drug Info | [59] | |||
28 | 3-(1-Propyl-pyrrolidin-3-yl)-phenol | Drug Info | [67] | |||
29 | 3-(2-Benzylamino-ethoxy)-phenol | Drug Info | [68] | |||
30 | 3-(4-Benzyl-piperazin-1-yl)-phenol | Drug Info | [69] | |||
31 | 3-(4-Methyl-piperidin-1-ylmethyl)-1H-indole | Drug Info | [70] | |||
32 | 3-(4-Phenyl-piperazin-1-ylmethyl)-1H-indole | Drug Info | [70] | |||
33 | 3-(4-Phenyl-piperidin-1-ylmethyl)-1H-indole | Drug Info | [70] | |||
34 | 4-(2-Benzylamino-ethoxy)-1,3-dihydro-indol-2-one | Drug Info | [68] | |||
35 | 4-(4-Benzyl-piperazin-1-yl)-1H-benzoimidazole | Drug Info | [69] | |||
36 | 4-(4-Benzyl-piperazin-1-yl)-1H-indole | Drug Info | [69] | |||
37 | 4-(4-Benzyl-piperazin-1-yl)-5-chloro-1H-indole | Drug Info | [69] | |||
38 | 4-(4-Benzyl-piperazin-1-yl)-7-bromo-1H-indole | Drug Info | [69] | |||
39 | 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [71] | |||
40 | 4-Dipropylamino-cyclohex-1-enecarbonitrile | Drug Info | [59] | |||
41 | 5-OH-DPAT | Drug Info | [72] | |||
42 | A-690344 | Drug Info | [74] | |||
43 | A-706149 | Drug Info | [75] | |||
44 | A-987306 | Drug Info | [54] | |||
45 | Azaperone | Drug Info | [76] | |||
46 | Benzyl-[2-(1H-indazol-4-yloxy)-ethyl]-amine | Drug Info | [68] | |||
47 | Benzyl-[2-(1H-indol-4-yloxy)-ethyl]-amine | Drug Info | [68] | |||
48 | D-189 | Drug Info | [77] | |||
49 | D-190 | Drug Info | [77] | |||
50 | D-192 | Drug Info | [77] | |||
51 | D-193 | Drug Info | [77] | |||
52 | D-203 | Drug Info | [77] | |||
53 | D-210 | Drug Info | [77] | |||
54 | D-218 | Drug Info | [77] | |||
55 | D-219 | Drug Info | [77] | |||
56 | D-220 | Drug Info | [77] | |||
57 | D-237 | Drug Info | [78] | |||
58 | D-264 | Drug Info | [79] | |||
59 | D-315 | Drug Info | [80] | |||
60 | D-366 | Drug Info | [72] | |||
61 | Etoloxamine | Drug Info | [58] | |||
62 | FLUMEZAPINE | Drug Info | [81] | |||
63 | FLUTROLINE | Drug Info | [82] | |||
64 | ISOCLOZAPINE | Drug Info | [66] | |||
65 | ISOLOXAPINE | Drug Info | [83] | |||
66 | L-741626 | Drug Info | [84] | |||
67 | L-741742 | Drug Info | [85] | |||
68 | N-(4-Dipropylaminobutyl)-4-biphenylcarboxamide | Drug Info | [60] | |||
69 | N-(4-Propylaminobutyl)-4-biphenylcarboxamide | Drug Info | [60] | |||
70 | PG-01037 | Drug Info | [93] | |||
71 | QUINPIROLE | Drug Info | [95] | |||
72 | R-226161 | Drug Info | [96] | |||
73 | SB-271046 | Drug Info | [97] | |||
74 | STEPHOLIDINE | Drug Info | [99] | |||
75 | UH-232 | Drug Info | [100] | |||
76 | [2-(1H-Benzoimidazol-4-yloxy)-ethyl]-benzyl-amine | Drug Info | [68] | |||
Antagonist | [+] 20 Antagonist drugs | + | ||||
1 | GSK598809 | Drug Info | [36] | |||
2 | ONC201 | Drug Info | [10] | |||
3 | GSK618334 | Drug Info | [36] | |||
4 | AVE-5997EF | Drug Info | [23] | |||
5 | S-33138 | Drug Info | [44], [45] | |||
6 | PD-157533 | Drug Info | [23] | |||
7 | PD-157695 | Drug Info | [23] | |||
8 | PD-158771 | Drug Info | [23] | |||
9 | AS-8112 | Drug Info | [48] | |||
10 | BP4.879a | Drug Info | [23] | |||
11 | Dianicline+rimonabant | Drug Info | [49] | |||
12 | PNU-177864 | Drug Info | [23] | |||
13 | RGH-1756 | Drug Info | [23] | |||
14 | SB-277011 | Drug Info | [23] | |||
15 | (+)-AJ76 | Drug Info | [53] | |||
16 | (+)-S-14297 | Drug Info | [55] | |||
17 | AS-9705 | Drug Info | [48] | |||
18 | nafadotride | Drug Info | [87] | |||
19 | NGB 2904 | Drug Info | [88] | |||
20 | [3H]spiperone | Drug Info | [103], [104] | |||
Partial agonist | [+] 1 Partial agonist drugs | + | ||||
1 | RP5063 | Drug Info | [37] | |||
Ligand | [+] 2 Ligand drugs | + | ||||
1 | Aryl piperazine derivative 1 | Drug Info | [39] | |||
2 | Aryl piperazine derivative 6 | Drug Info | [39] | |||
Binder | [+] 2 Binder drugs | + | ||||
1 | U-99194A | Drug Info | [23] | |||
2 | BTS-79018 | Drug Info | [23] | |||
Modulator (allosteric modulator) | [+] 1 Modulator (allosteric modulator) drugs | + | ||||
1 | SB269652 | Drug Info | [98] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
1 | Neuroactive ligand-receptor interaction | |||||
2 | Dopaminergic synapse | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Dopamine receptors | |||||
2 | G alpha (i) signalling events | |||||
WikiPathways | [+] 6 WikiPathways | + | ||||
1 | Monoamine GPCRs | |||||
2 | GPCRs, Class A Rhodopsin-like | |||||
3 | GPCR ligand binding | |||||
4 | GPCR downstream signaling | |||||
5 | Nicotine Activity on Dopaminergic Neurons | |||||
6 | GPCRs, Other |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Radium 223 dichloride for prostate cancer treatment. Drug Des Devel Ther. 2017 Sep 6;11:2643-2651. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7671). | |||||
REF 3 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 953). | |||||
REF 4 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. | |||||
REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7295). | |||||
REF 6 | Update on ropinirole in the treatment of Parkinson's disease. Neuropsychiatr Dis Treat. 2009;5:33-6. | |||||
REF 7 | Pharmaceutical Research Companies Are Developing More Than 300 Medicines to Treat Mental Illnesses. Pharmaceutical Research and Manufacturers of America report.2010. | |||||
REF 8 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 9 | ClinicalTrials.gov (NCT01188967) Effectiveness of GSK598809, a Selective D3 Antagonist, Added to Cognitive Behavioral Therapy and Nicotine Replacement Therapy for Smoking Cessation and Prevention of Very Early Relapse to Smoking. U.S. National Institutes of Health. | |||||
REF 10 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 11 | ClinicalTrials.gov (NCT01490086) RP5063 in Subjects With Schizophrenia or Schizoaffective Disorder. U.S. National Institutes of Health. | |||||
REF 12 | ClinicalTrials.gov (NCT03544229) A Study to Evaluate the Efficacy and Safety of TAK-906 in Adult Participants With Symptomatic Idiopathic or Diabetic Gastroparesis. U.S. National Institutes of Health. | |||||
REF 13 | ClinicalTrials.gov (NCT00513279) To Investigate If Single Doses Of GSK618334 Are Safe And To Investigate Blood Levels Of GSK618334. U.S. National Institutes of Health. | |||||
REF 14 | Designing drugs for the treatment of female sexual dysfunction. Drug Discov Today. 2007 Sep;12(17-18):757-66. | |||||
REF 15 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 954). | |||||
REF 16 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001472) | |||||
REF 17 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012940) | |||||
REF 18 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7625). | |||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012397) | |||||
REF 20 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018413) | |||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014544) | |||||
REF 22 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026348) | |||||
REF 23 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. | |||||
REF 24 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 129). | |||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013394) | |||||
REF 26 | S32504, a novel naphtoxazine agonist at dopamine D3/D2 receptors: II. Actions in rodent, primate, and cellular models of antiparkinsonian activity ... J Pharmacol Exp Ther. 2004 Jun;309(3):921-35. | |||||
REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009088) | |||||
REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027143) | |||||
REF 29 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009126) | |||||
REF 30 | The dopamine stabilizer (-)-OSU6162 occupies a subpopulation of striatal dopamine D2/D3 receptors: an [(11)C]raclopride PET study in healthy human subjects. Neuropsychopharmacology. 2015 Jan;40(2):472-9. | |||||
REF 31 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 143). | |||||
REF 32 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005975) | |||||
REF 33 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
REF 34 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031127) | |||||
REF 35 | Pharmacology of pramipexole, a dopamine D3-preferring agonist useful in treating Parkinson's disease. Clin Neuropharmacol. 1998 May-Jun;21(3):141-51. | |||||
REF 36 | Clinical pipeline report, company report or official report of GlaxoSmithKline (2009). | |||||
REF 37 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 38 | Safety, Pharmacokinetics, and Pharmacodynamics of Trazpiroben (TAK-906), a Novel Selective D 2 /D 3 Receptor Antagonist: A Phase 1 Randomized, Placebo-Controlled Single- and Multiple-Dose Escalation Study in Healthy Participants. Clin Pharmacol Drug Dev. 2021 Jan 18. | |||||
REF 39 | 5-HT1A receptor ligands and their therapeutic applications: review of new patents.Expert Opin Ther Pat. 2018 Sep;28(9):679-689. | |||||
REF 40 | Quinelorane, a dopamine D3/D2 receptor agonist, reduces prepulse inhibition of startle and ventral pallidal GABA efflux: time course studies.Pharmacol Biochem Behav.2008 Oct;90(4):686-90. | |||||
REF 41 | Association of dopamine-related genetic loci to dopamine D3 receptor antagonist ABT-925 clinical response.Transl Psychiatry.2013 Apr 9;3:e245. | |||||
REF 42 | BP 897, a selective dopamine D3 receptor ligand with therapeutic potential for the treatment of cocaine-addiction.CNS Drug Rev.2003 Summer;9(2):141-58. | |||||
REF 43 | A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem. 1994 Apr 15;37(8):1060-2. | |||||
REF 44 | The dopamine D3 receptor antagonist, S33138, counters cognitive impairment in a range of rodent and primate procedures. Int J Neuropsychopharmacol. 2010 Sep;13(8):1035-51. | |||||
REF 45 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 46 | F15063, a potential antipsychotic with dopamine D(2)/D(3) antagonist, 5-HT(1A) agonist and D(4) partial agonist properties: (IV) duration of brain D2-like receptor occupancy and antipsychotic-like activity versus plasma concentration in mice.Naunyn Schmiedebergs Arch Pharmacol.2007 Jun;375(4):241-50. | |||||
REF 47 | S33084, a novel, potent, selective, and competitive antagonist at dopamine D(3)-receptors: II. Functional and behavioral profile compared with GR218,231 and L741,626. J Pharmacol Exp Ther. 2000 Jun;293(3):1063-73. | |||||
REF 48 | Emerging drugs for chemotherapy-induced emesis. Expert Opin Emerg Drugs. 2006 Mar;11(1):137-51. | |||||
REF 49 | Potent activation of dopamine D3/D2 heterodimers by the antiparkinsonian agents, S32504, pramipexole and ropinirole. J Neurochem. 2003 Nov;87(3):631-41. | |||||
REF 50 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009126) | |||||
REF 51 | Design, synthesis, and binding affinities of potential positron emission tomography (PET) ligands with optimal lipophilicity for brain imaging of t... Bioorg Med Chem. 2009 Jan 15;17(2):758-66. | |||||
REF 52 | Effects of YM-43611, a novel dopamine D2-like receptor antagonist, on immediate early gene expression in the rat forebrain. Neuropsychopharmacology. 1997 Jul;17(1):27-33. | |||||
REF 53 | Molecular cloning and characterization of a novel dopamine receptor (D3) as a target for neuroleptics. Nature. 1990 Sep 13;347(6289):146-51. | |||||
REF 54 | cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain... J Med Chem. 2008 Nov 27;51(22):7094-8. | |||||
REF 55 | S 14297, a novel selective ligand at cloned human dopamine D3 receptors, blocks 7-OH-DPAT-induced hypothermia in rats. Eur J Pharmacol. 1994 Aug 1;260(2-3):R3-5. | |||||
REF 56 | Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. | |||||
REF 57 | Substituted 3-phenylpiperidines: new centrally acting dopamine autoreceptor antagonists. J Med Chem. 1993 Oct 15;36(21):3188-96. | |||||
REF 58 | Dopamine/serotonin receptor ligands. 9. Oxygen-containing midsized heterocyclic ring systems and nonrigidized analogues. A step toward dopamine D5 ... J Med Chem. 2004 Aug 12;47(17):4155-8. | |||||
REF 59 | Conjugated enynes as nonaromatic catechol bioisosteres: synthesis, binding experiments, and computational studies of novel dopamine receptor agonis... J Med Chem. 2000 Feb 24;43(4):756-62. | |||||
REF 60 | Novel D3 selective dopaminergics incorporating enyne units as nonaromatic catechol bioisosteres: synthesis, bioactivity, and mutagenesis studies. J Med Chem. 2008 Nov 13;51(21):6829-38. | |||||
REF 61 | Synthesis and neuropharmacological evaluation of 2-aryl- and alkylapomorphines. Bioorg Med Chem. 2008 Apr 1;16(7):3773-9. | |||||
REF 62 | Molecular modeling of the three-dimensional structure of dopamine 3 (D3) subtype receptor: discovery of novel and potent D3 ligands through a hybri... J Med Chem. 2003 Oct 9;46(21):4377-92. | |||||
REF 63 | Synthesis and biological investigations of dopaminergic partial agonists preferentially recognizing the D4 receptor subtype. Bioorg Med Chem Lett. 2006 Jun 1;16(11):2955-9. | |||||
REF 64 | Synthesis of novel lactam derivatives and their evaluation as ligands for the dopamine receptors, leading to a D(4)-selective ligand. Bioorg Med Chem. 2007 Sep 1;15(17):5811-8. | |||||
REF 65 | Piperidinylpyrroles: design, synthesis and binding properties of novel and selective dopamine D4 receptor ligands. Bioorg Med Chem Lett. 1999 Nov 1;9(21):3143-6. | |||||
REF 66 | Affinity of 10-(4-methylpiperazino)dibenz[b,f]oxepins for clozapine and spiroperidol binding sites in rat brain. J Med Chem. 1982 Jul;25(7):855-8. | |||||
REF 67 | Regioselective synthesis of 3-aryl substituted pyrrolidines via palladium catalyzed arylation: pharmacological evaluation for central dopaminergic and serotonergic activity, Bioorg. Med. Chem. Lett. 7(3):241-246 (1997). | |||||
REF 68 | New generation dopaminergic agents. 7. Heterocyclic bioisosteres that exploit the 3-OH-phenoxyethylamine D2 template. Bioorg Med Chem Lett. 1999 Sep 6;9(17):2593-8. | |||||
REF 69 | New generation dopaminergic agents. 5. Heterocyclic bioisosteres that exploit the 3-OH-N1-phenylpiperazine dopaminergic template. Bioorg Med Chem Lett. 1998 Oct 6;8(19):2675-80. | |||||
REF 70 | 3-((4-(4-Chlorophenyl)piperazin-1-yl)-methyl)-1H-pyrrolo-2,3-b-pyridine: an antagonist with high affinity and selectivity for the human dopamine D4... J Med Chem. 1996 May 10;39(10):1941-2. | |||||
REF 71 | Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97. | |||||
REF 72 | Development of (S)-N6-(2-(4-(isoquinolin-1-yl)piperazin-1-yl)ethyl)-N6-propyl-4,5,6,7-tetrahydrobenzo[d]-thiazole-2,6-diamine and its analogue as a... J Med Chem. 2010 Feb 11;53(3):1023-37. | |||||
REF 73 | Iodinated 2-aminotetralins and 3-amino-1-benzopyrans: ligands for dopamine D2 and D3 receptors. J Med Chem. 1994 Nov 25;37(24):4245-50. | |||||
REF 74 | Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: 1H-pyrimidin-2-one derivatives. Bioorg Med Chem Lett. 2006 Feb;16(3):490-4. | |||||
REF 75 | Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: Quinolin(di)one and benzazepin(di)one derivatives. herve.genes... Bioorg Med Chem Lett. 2006 Feb;16(3):658-62. | |||||
REF 76 | Evaluation of the effects of the enantiomers of reduced haloperidol, azaperol, and related 4-amino-1-arylbutanols on dopamine and sigma receptors. J Med Chem. 1993 Nov 26;36(24):3929-36. | |||||
REF 77 | Bioisosteric heterocyclic versions of 7-{[2-(4-phenyl-piperazin-1-yl)ethyl]propylamino}-5,6,7,8-tetrahydronaphthalen-2-ol: identification of highly... J Med Chem. 2008 May 22;51(10):3005-19. | |||||
REF 78 | Structurally constrained hybrid derivatives containing octahydrobenzo[g or f]quinoline moieties for dopamine D2 and D3 receptors: binding character... J Med Chem. 2008 Dec 25;51(24):7806-19. | |||||
REF 79 | Investigation of various N-heterocyclic substituted piperazine versions of 5/7-{[2-(4-aryl-piperazin-1-yl)-ethyl]-propyl-amino}-5,6,7,8-tetrahydro-... Bioorg Med Chem. 2009 Jun 1;17(11):3923-33. | |||||
REF 80 | Further delineation of hydrophobic binding sites in dopamine D(2)/D(3) receptors for N-4 substituents on the piperazine ring of the hybrid template... Bioorg Med Chem. 2010 Aug 1;18(15):5661-74. | |||||
REF 81 | Effects of conformationally restricted 4-piperazinyl-10H-thienobenzodiazepine neuroleptics on central dopaminergic and cholinergic systems. J Med Chem. 1982 Oct;25(10):1133-40. | |||||
REF 82 | Neuroleptic activity in 5-aryltetrahydro-gamma-carbolines. J Med Chem. 1980 Jun;23(6):635-43. | |||||
REF 83 | Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. J Med Chem. 1981 Sep;24(9):1021-6. | |||||
REF 84 | Synthesis and characterization of selective dopamine D2 receptor antagonists. 2. Azaindole, benzofuran, and benzothiophene analogs of L-741,626. Bioorg Med Chem. 2010 Jul 15;18(14):5291-300. | |||||
REF 85 | 5-(4-Chlorophenyl)-4-methyl-3-(1-(2-phenylethyl)piperidin-4-yl)isoxazole: a potent, selective antagonist at human cloned dopamine D4 receptors. J Med Chem. 1996 May 10;39(10):1943-5. | |||||
REF 86 | A functional test identifies dopamine agonists selective for D3 versus D2 receptors. Neuroreport. 1995 Jan 26;6(2):329-32. | |||||
REF 87 | Nafadotride, a potent preferential dopamine D3 receptor antagonist, activates locomotion in rodents. J Pharmacol Exp Ther. 1995 Dec;275(3):1239-46. | |||||
REF 88 | Pharmacological actions of NGB 2904, a selective dopamine D3 receptor antagonist, in animal models of drug addiction. CNS Drug Rev. 2007 Summer;13(2):240-59. | |||||
REF 89 | Neurochemical and functional characterization of the preferentially selective dopamine D3 agonist PD 128907. J Pharmacol Exp Ther. 1995 Dec;275(3):1355-66. | |||||
REF 90 | Characterization of binding of [3H]PD 128907, a selective dopamine D3 receptor agonist ligand, to CHO-K1 cells. Life Sci. 1995;57(15):1401-10. | |||||
REF 91 | Pharmacological characterization of PD 152255, a novel dimeric benzimidazole dopamine D3 antagonist. Pharmacol Biochem Behav. 1998 Feb;59(2):487-93. | |||||
REF 92 | Lack of abuse potential in a highly selective dopamine D3 agonist, PF-592,379, in drug self-administration and drug discrimination in rats. Behav Pharmacol. 2012 Jun;23(3):280-91. | |||||
REF 93 | Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3... J Med Chem. 2007 Aug 23;50(17):4135-46. | |||||
REF 94 | Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther. 2002 Nov;303(2):791-804. | |||||
REF 95 | 1,1'-Disubstituted ferrocenes as molecular hinges in mono- and bivalent dopamine receptor ligands. J Med Chem. 2009 Nov 12;52(21):6860-70. | |||||
REF 96 | Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-a... Bioorg Med Chem. 2007 Jun 1;15(11):3649-60. | |||||
REF 97 | Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. | |||||
REF 98 | Investigation of the binding and functional properties of extended length D3 dopamine receptor-selective antagonists. Eur Neuropsychopharmacol. 2015 Sep;25(9):1448-61. | |||||
REF 99 | Dibenzazecine scaffold rebuilding--is the flexibility always essential for high dopamine receptor affinities Bioorg Med Chem. 2009 Oct 1;17(19):6898-907. | |||||
REF 100 | (Dipropylamino)-tetrahydronaphthofurans: centrally acting serotonin agonists and dopamine agonists-antagonists, Bioorg. Med. Chem. Lett. 7(21):2759-2764 (1997). | |||||
REF 101 | Radioligand binding characterization of putative dopamine D3 receptor in human peripheral blood lymphocytes with [3H]7-OH-DPAT. J Neuroimmunol. 1995 May;58(2):139-44. | |||||
REF 102 | 7-OH-DPAT and PD 128907 selectively activate the D3 dopamine receptor in a novel environment. Neuropsychopharmacology. 2003 Jan;28(1):100-7. | |||||
REF 103 | Regulation of human D(1), d(2(long)), d(2(short)), D(3) and D(4) dopamine receptors by amiloride and amiloride analogues. Br J Pharmacol. 2000 Jul;130(5):1045-59. | |||||
REF 104 | Modeling the similarity and divergence of dopamine D2-like receptors and identification of validated ligand-receptor complexes. J Med Chem. 2005 Feb 10;48(3):694-709. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.