Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T78709
|
||||
Former ID |
TTDS00098
|
||||
Target Name |
5-hydroxytryptamine 1A receptor
|
||||
Gene Name |
HTR1A
|
||||
Synonyms |
5-HT-1A; 5-HT1A; 5-HT1A receptor; 5-hydroxytryptamine receptor 1A; G-21; Serotonin receptor; Serotonin receptor 1A; HTR1A
|
||||
Target Type |
Successful
|
||||
Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
Addiction [ICD code not available] | |||||
Aggressive non-hodgkin's lymphoma [ICD9: 200, 201, 202, 202.8, 208.9; ICD10: C81, C81-C86, C82-C85, C91-C95] | |||||
Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | |||||
Alzheimer disease; Peripheral sensory neuropathies; Lateral sclerosis [ICD9:331.0, 356.0, 356.8; ICD10: G30, G64, G90.0, G12.2] | |||||
Bulimia nervosa; Severe mood disorders [ICD9: 296, 307.51; ICD10: F30-F39, F50.2] | |||||
Coronary artery disease [ICD9: 410-414, 429.2; ICD10: I20-I25] | |||||
Cervical dystonia; Spasm [ICD9:333.83, 728.85; ICD10: G24.3, R25.2] | |||||
Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3] | |||||
Depression [ICD9: 311; ICD10: F30-F39] | |||||
Eating disorder [ICD9: 278, 307.5, 401, 428.0; ICD10: E66, F50, I10-I16, I50] | |||||
Female sexual dysfunction [ICD9: 302.7; ICD10: F52] | |||||
Generalized anxiety disorder [ICD9: 300, 300.02, 311; ICD10: F32, F40-F42, F41.1] | |||||
Generalized anxiety disorder; Social phobia [ICD9: 300, 300.02, 300.23; ICD10: F40-F42, F40.1, F41.1, F93.2] | |||||
Hypoactive sexual desire disorder [ICD10: F52.0] | |||||
Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
Insomnia [ICD9: 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F51.0, G47.0] | |||||
Major depressive disorder; Episode; Anxiety [ICD9: 296.2, 296.3, 300; ICD10: F32, F32.2, F32.3, F33, F40-F42] | |||||
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
Mood disorder [ICD10: F30-F39] | |||||
Migraine [ICD9: 346; ICD10: G43] | |||||
Post-traumatic stress disorder [ICD9: 309.81; ICD10: F43.1] | |||||
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
Psychiatric disorder [ICD9: 290-319; ICD10: F01-F99] | |||||
Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
Psychotic disorders [ICD9: 290-299; ICD10: F20-F29] | |||||
Premature ejaculation [ICD9: 302.75; ICD10: F52.4] | |||||
Severe mood disorders [ICD9: 296; ICD10: F30-F39] | |||||
Schizoaffective disorder; Schizophrenia [ICD9: 295, 295.70; ICD10: F20, F25] | |||||
Schizophrenia [ICD9: 295; ICD10: F20] | |||||
Urinary incontinence [ICD9: 788.3; ICD10: N39.3, N39.4, R32] | |||||
Unspecified [ICD code not available] | |||||
Function |
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling inhibits adenylate cyclase activity and activates a phosphatidylinositol-calcium second messenger system that regulates the release of Ca(2+) ions from intracellular stores. Plays a role in the regulation of 5- hydroxytryptamine release and in the regulation of dopamine and 5- hydroxytryptamine metabolism. Plays a role in the regulation of dopamine and 5-hydroxytryptamine levels in the brain, and thereby affects neural activity, mood and behavior. Plays a role in the response to anxiogenic stimuli.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T78709
|
||||
UniProt ID | |||||
Sequence |
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC RQ |
||||
Drugs and Mode of Action | |||||
Drug(s) | Buspirone | Drug Info | Approved | Anxiety disorder | [1], [2] |
Flibanserin | Drug Info | Approved | Mood disorder | [3], [4] | |
OPC-34712 | Drug Info | Approved | Major depressive disorder | [5], [6] | |
TERTATOLOL | Drug Info | Approved | Hypertension | [7], [8] | |
Trazodone | Drug Info | Approved | Depression | [9], [10] | |
Treximet | Drug Info | Approved | Migraine | [11] | |
Urapidil | Drug Info | Approved | Hypertension | [8] | |
Vilazodone | Drug Info | Approved | Major depressive disorder | [12], [13] | |
CM-2395 | Drug Info | Phase 3 | Schizophrenia | [14] | |
Flibanserin | Drug Info | Phase 3 | Female sexual dysfunction | [15], [4] | |
LECOZOTAN HYDROCHLORIDE | Drug Info | Phase 2/3 | Cognitive disorders | [16] | |
Eltoprazine | Drug Info | Phase 2 | Aggressive non-hodgkin's lymphoma | [17] | |
Ensaculin hydrochloride | Drug Info | Phase 2 | Parkinson's disease | [18] | |
Mazapertine succinate | Drug Info | Phase 2 | Psychotic disorders | [19] | |
MIN-117 | Drug Info | Phase 2 | Major depressive disorder | [20] | |
MN-305 | Drug Info | Phase 2 | Severe mood disorders | [21] | |
Neu-P11 | Drug Info | Phase 2 | Insomnia | [22] | |
OPC-14523 | Drug Info | Phase 2 | Bulimia nervosa; Severe mood disorders | [15] | |
ORG-13011 | Drug Info | Phase 2 | Psychotic disorders | [23] | |
RP5063 | Drug Info | Phase 2 | Schizoaffective disorder; Schizophrenia | [24] | |
S-15535 | Drug Info | Phase 2 | Anxiety disorder | [25], [26] | |
S-16924 | Drug Info | Phase 2 | Anxiety disorder | [27], [28], [29] | |
SDZ-MAR-327 | Drug Info | Phase 2 | Psychotic disorders | [30], [31] | |
SUN N4057 | Drug Info | Phase 2 | Coronary artery disease | [32] | |
TGBA01AD | Drug Info | Phase 2 | Severe mood disorders | [21] | |
TGFK08AA-ER | Drug Info | Phase 2 | Generalized anxiety disorder | [33] | |
TGFK09SD-ER | Drug Info | Phase 2 | Hypoactive sexual desire disorder | [34] | |
TGWOOAA | Drug Info | Phase 2 | Generalized anxiety disorder; Social phobia | [35] | |
Zalospirone | Drug Info | Phase 2 | Anxiety disorder | [36], [37] | |
1192U90 | Drug Info | Phase 1 | Psychotic disorders | [38] | |
AV-965 | Drug Info | Phase 1 | Alzheimer disease | [39] | |
DSP-1053 | Drug Info | Phase 1 | Major depressive disorder | [40] | |
GSK-958108 | Drug Info | Phase 1 | Premature ejaculation | [41] | |
OPC-14523 | Drug Info | Phase 1 | Female sexual dysfunction | [15] | |
SSR-181507 | Drug Info | Phase 1 | Schizophrenia | [31] | |
Umespirone | Drug Info | Phase 1 | Anxiety disorder | [42] | |
CM-2236 | Drug Info | Preclinical | Post-traumatic stress disorder | [43] | |
PD-158771 | Drug Info | Preclinical | Schizophrenia | [31] | |
LYSERGIC ACID DIETHYLAMIDE | Drug Info | Withdrawn from market | Addiction | [44], [45] | |
Bifeprunox | Drug Info | Discontinued in Phase 3 | Schizophrenia | [31] | |
BMS-181100 | Drug Info | Discontinued in Phase 3 | Psychotic disorders | [46], [47] | |
Flesinoxan | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [48], [49] | |
Sunepitron | Drug Info | Discontinued in Phase 3 | Discovery agent | [50] | |
TIOSPIRONE | Drug Info | Discontinued in Phase 3 | Discovery agent | [51], [52] | |
Xaliproden | Drug Info | Discontinued in Phase 3 | Alzheimer disease; Peripheral sensory neuropathies; Lateral sclerosis | [53] | |
Adatanserin | Drug Info | Discontinued in Phase 2 | Severe mood disorders | [21] | |
ALNESPIRONE | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [54] | |
AP-521 | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [55] | |
DU 125530 | Drug Info | Discontinued in Phase 2 | Mood disorder | [56] | |
GSK163090 | Drug Info | Discontinued in Phase 2 | Major depressive disorder; Episode; Anxiety | [57] | |
LESOPITRON DIHYDROCHLORIDE | Drug Info | Discontinued in Phase 2 | Mood disorder | [58] | |
MAZAPERTINE | Drug Info | Discontinued in Phase 2 | Discovery agent | [59] | |
PRX-00023 | Drug Info | Discontinued in Phase 2 | Severe mood disorders | [21] | |
REC-15/3079 | Drug Info | Discontinued in Phase 2 | Urinary incontinence | [60], [61] | |
Robalzotan | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [62], [63] | |
Sarizotan | Drug Info | Discontinued in Phase 2 | Parkinson's disease | [64] | |
BINOSPIRONE MESYLATE | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [65] | |
DU-29894 | Drug Info | Discontinued in Phase 1 | Psychotic disorders | [66] | |
E2101 | Drug Info | Discontinued in Phase 1 | Cervical dystonia; Spasm | [67] | |
Ebalzotan | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [68] | |
Eptapirone | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [69] | |
GR-127607 | Drug Info | Discontinued in Phase 1 | Migraine | [70] | |
Nerisopam | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [71] | |
SLV-313 | Drug Info | Discontinued in Phase 1 | Schizophrenia | [31] | |
SUN-8399 | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [72] | |
U-93385 | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [73] | |
1192U90 | Drug Info | Terminated | Schizophrenia | [31] | |
A-74283 | Drug Info | Terminated | Hypertension | [74] | |
A-80426 | Drug Info | Terminated | Discovery agent | [75] | |
Anpirtoline | Drug Info | Terminated | Pain | [76] | |
BMY-7378 | Drug Info | Terminated | Discovery agent | [77], [78] | |
BTS-79018 | Drug Info | Terminated | Schizophrenia | [31] | |
CGS-18102A | Drug Info | Terminated | Anxiety disorder | [79] | |
CP-293019 | Drug Info | Terminated | Discovery agent | [80], [81] | |
Du-123015 | Drug Info | Terminated | Anxiety disorder | [82] | |
Gepirone ER | Drug Info | Terminated | Depression | [21] | |
HT-90B | Drug Info | Terminated | Anxiety disorder | [83] | |
Ipsapirone | Drug Info | Terminated | Anxiety disorder | [84], [85] | |
LY-293284 | Drug Info | Terminated | Anxiety disorder | [86], [87] | |
NAN-190 | Drug Info | Terminated | Discovery agent | [88], [89] | |
RWJ-25730 | Drug Info | Terminated | Psychotic disorders | [90] | |
S-14506 | Drug Info | Terminated | Anxiety disorder | [91], [92] | |
SDZ 216-525 | Drug Info | Terminated | Discovery agent | [93], [94] | |
SDZ-MAR-327 | Drug Info | Terminated | Schizophrenia | [31] | |
SLV-307 | Drug Info | Terminated | Parkinson's disease | [95] | |
WAY 100135 | Drug Info | Terminated | Discovery agent | [96], [97] | |
WAY-100635 | Drug Info | Terminated | Eating disorder | [98], [99] | |
WB-4101 | Drug Info | Terminated | Discovery agent | [100], [101] | |
Sunepitron | Drug Info | Investigative | Unspecified | [102] | |
Inhibitor | (3-Chloro-phenyl)-piperazin-1-yl-methanone | Drug Info | [103] | ||
(R)-(-)-10-methyl-11-hydroxyaporphine | Drug Info | [104] | |||
(R)-11-Amino-2-methoxyaporphine | Drug Info | [105] | |||
(R)-2,11-Diaminoaporphine | Drug Info | [105] | |||
1,2,3,4-Tetrahydro-naphthalen-2-ylamine | Drug Info | [106] | |||
1,6-bis(4-(3-chlorophenyl)piperazin-1-yl)hexane | Drug Info | [107] | |||
1,6-bis(4-(3-methoxyphenyl)piperazin-1-yl)hexane | Drug Info | [107] | |||
1,6-bis(4-(pyridin-2-yl)piperazin-1-yl)hexane | Drug Info | [107] | |||
1,6-bis(4-m-tolylpiperazin-1-yl)hexane | Drug Info | [107] | |||
1,6-bis(4-phenylpiperazin-1-yl)hexane | Drug Info | [107] | |||
1-((S)-2-aminopropyl)-1H-indazol-6-ol | Drug Info | [108] | |||
1-(2,5-Dimethoxy-4-methyl-phenyl)-piperazine | Drug Info | [103] | |||
1-(2,5-Dimethoxy-phenyl)-piperazine | Drug Info | [103] | |||
1-(2,5-dimethoxyphenyl)propan-2-amine | Drug Info | [109] | |||
1-(2-((3-fluorophenoxy)methyl)phenyl)piperazine | Drug Info | [110] | |||
1-(2-(2-chlorophenoxy)pyridin-3-yl)piperazine | Drug Info | [111] | |||
1-(2-(2-fluorobenzyloxy)phenyl)piperazine | Drug Info | [110] | |||
1-(2-(3-fluorophenoxy)phenyl)piperazine | Drug Info | [110] | |||
1-(2-(4-fluorophenoxy)phenyl)piperazine | Drug Info | [110] | |||
1-(2-(benzyloxy)phenyl)piperazine | Drug Info | [110] | |||
1-(2-(phenoxymethyl)phenyl)piperazine | Drug Info | [110] | |||
1-(2-Butoxy-phenyl)-piperazine | Drug Info | [112] | |||
1-(2-Chloro-phenyl)-piperazine | Drug Info | [113] | |||
1-(2-Ethoxy-phenyl)-piperazine | Drug Info | [112] | |||
1-(2-Fluoro-phenyl)-piperazine | Drug Info | [112] | |||
1-(2-Isopropoxy-phenyl)-piperazine | Drug Info | [112] | |||
1-(2-Methoxy-phenyl)-4-propyl-piperazine | Drug Info | [114] | |||
1-(2-Methoxy-phenyl)-piperazine | Drug Info | [113] | |||
1-(2-methoxyphenyl)-4-pentylpiperazine | Drug Info | [115] | |||
1-(2-phenoxyphenyl)piperazine | Drug Info | [110] | |||
1-(3-(pentafluorosulfanyl)phenyl)propan-2-amine | Drug Info | [116] | |||
1-(3-Fluoro-phenyl)-piperazine | Drug Info | [112] | |||
1-(3-Nitro-phenyl)-piperazine | Drug Info | [112] | |||
1-(3-Trifluoromethyl-phenyl)-piperazine | Drug Info | [103] | |||
1-(4-Bromo-2,5-dimethoxy-phenyl)-piperazine | Drug Info | [103] | |||
1-(7-Methoxy-naphthalen-2-yl)-piperazine | Drug Info | [117] | |||
1-(benzyloxy)-2-(2-phenylethyl)benzene | Drug Info | [118] | |||
1-(benzyloxy)-2-[2-(3-methoxyphenyl)ethyl]benzene | Drug Info | [118] | |||
1-Benzyl-4-chroman-2-ylmethyl-piperazine | Drug Info | [119] | |||
1-Butyl-4-(2-methoxy-phenyl)-piperazine | Drug Info | [114] | |||
1-Ethyl-4-(2-methoxy-phenyl)-piperazine | Drug Info | [114] | |||
1-Methyl-1,3-dihydro-indol-2-one | Drug Info | [120] | |||
1-Naphthalen-1-yl-piperazine | Drug Info | [106] | |||
1-Naphthalen-2-yl-piperazine | Drug Info | [106] | |||
1-Propyl-3-(3-trifluoromethyl-phenyl)-pyrrolidine | Drug Info | [121] | |||
1-[(3-methoxybenzyl)oxy]-2-(2-phenylethyl)benzene | Drug Info | [118] | |||
2-(2'-methyl-biphenyl-3-yl)-ethylamine | Drug Info | [122] | |||
2-(2-Amino-propyl)-5-bromo-4-methoxy-phenol | Drug Info | [109] | |||
2-(2-chlorophenoxy)-3-(piperidin-4-yl)pyridine | Drug Info | [111] | |||
2-(2-fluorophenoxy)-3-(piperidin-4-yl)pyridine | Drug Info | [111] | |||
2-(2-Methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [109] | |||
2-(2-methoxyphenoxy)-3-(piperidin-4-yl)pyridine | Drug Info | [111] | |||
2-(3-Bromophenylthio)-N,N-dimethylethanamine | Drug Info | [123] | |||
2-(3-Methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [109] | |||
2-(4-Benzyl-piperidin-1-ylmethyl)-chroman-4-one | Drug Info | [119] | |||
2-(4-Bromo-2-methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [109] | |||
2-(4-Bromo-phenyl)-1-methyl-ethylamine | Drug Info | [109] | |||
2-(4-Methyl-piperazin-1-yl)-4-phenyl-pyrimidine | Drug Info | [124] | |||
2-(5-Methoxy-1H-indol-3-yl)-1-methyl-ethylamine | Drug Info | [125] | |||
2-(Biphenyl-3-ylthio)-N,N-dimethylethanamine | Drug Info | [123] | |||
2-Dipropylamino-1,2,3,4-tetrahydro-anthracen-9-ol | Drug Info | [126] | |||
2-phenoxy-3-(piperidin-4-yl)pyridine | Drug Info | [111] | |||
2-Piperazin-1-yl-benzonitrile | Drug Info | [112] | |||
2-Piperazin-1-yl-phenol | Drug Info | [103] | |||
2-{[2-(2-phenylethyl)phenoxy]methyl}pyridine | Drug Info | [118] | |||
3-(1,2,3,6-Tetrahydro-pyridin-4-yl)-1H-indole | Drug Info | [127] | |||
3-(1-Propyl-pyrrolidin-3-yl)-phenol | Drug Info | [121] | |||
3-(2-Amino-propyl)-1H-indol-5-ol | Drug Info | [125] | |||
3-(2-Benzylamino-ethoxy)-phenol | Drug Info | [128] | |||
3-(3-Methanesulfonyl-phenyl)-1-propyl-pyrrolidine | Drug Info | [121] | |||
3-(4-Benzyl-piperidin-1-ylmethyl)-chroman-4-one | Drug Info | [119] | |||
3-(4-Benzyl-piperidin-1-ylmethyl)-chromen-4-one | Drug Info | [119] | |||
3-(piperidin-4-yl)-2-(o-tolyloxy)pyridine | Drug Info | [111] | |||
3-Amino-1-(2-amino-5-methoxy-phenyl)-propan-1-one | Drug Info | [103] | |||
3-Butyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol | Drug Info | [129] | |||
3-Ethyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol | Drug Info | [129] | |||
3-Naphthalen-1-yl-1-propyl-pyrrolidine | Drug Info | [121] | |||
3-Naphthalen-1-yl-pyrrolidine | Drug Info | [121] | |||
3-Phenyl-1-propyl-pyrrolidine | Drug Info | [121] | |||
3-{[2-(2-phenylethyl)phenoxy]methyl}pyridine | Drug Info | [118] | |||
4-(1H-indol-4-yloxy)-1-(isopropylamino)butan-2-ol | Drug Info | [130] | |||
4-(2-(2-fluoro-5-methylphenoxy)phenyl)piperidine | Drug Info | [110] | |||
4-(2-(2-fluorobenzyloxy)phenyl)piperidine | Drug Info | [110] | |||
4-(2-(3-chlorophenoxy)phenyl)piperidine | Drug Info | [110] | |||
4-(2-(3-fluorophenoxy)phenyl)piperidine | Drug Info | [110] | |||
4-(2-(4-fluorobenzyloxy)phenyl)piperidine | Drug Info | [110] | |||
4-(2-(4-fluorophenoxy)phenyl)piperidine | Drug Info | [110] | |||
4-(2-(benzyloxy)-3-fluorophenyl)piperidine | Drug Info | [110] | |||
4-(2-(benzyloxy)-6-fluorophenyl)piperidine | Drug Info | [110] | |||
4-(2-(benzyloxy)phenyl)piperidine | Drug Info | [110] | |||
4-(2-fluoro-6-(2-fluorophenoxy)phenyl)piperidine | Drug Info | [111] | |||
4-(2-fluoro-6-(3-fluorophenoxy)phenyl)piperidine | Drug Info | [110] | |||
4-(2-fluoro-6-(4-fluorophenoxy)phenyl)piperidine | Drug Info | [110] | |||
4-(2-fluoro-6-phenoxyphenyl)piperidine | Drug Info | [110] | |||
4-(2-phenoxyphenyl)piperidine | Drug Info | [110] | |||
4-(3-fluoro-2-phenoxyphenyl)piperidine | Drug Info | [110] | |||
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [131] | |||
4-Benzyl-1-chroman-2-ylmethyl-piperidine | Drug Info | [119] | |||
4-Benzyl-1-chroman-3-ylmethyl-piperidine | Drug Info | [119] | |||
5,6-dichloro-3,4-dihydroquinazolin-2-amine | Drug Info | [132] | |||
5-chloro-3,4-dihydroquinazolin-2-amine | Drug Info | [132] | |||
5-chloro-4-ethyl-3,4-dihydroquinazolin-2-amine | Drug Info | [132] | |||
5-chloro-4-methyl-3,4-dihydroquinazolin-2-amine | Drug Info | [132] | |||
8-Methoxy-1,2,3,4-tetrahydro-naphthalen-2-ylamine | Drug Info | [126] | |||
8-Methoxy-2-(4-methyl-piperazin-1-yl)-quinoline | Drug Info | [106] | |||
8-Methoxy-2-piperazin-1-yl-quinoline | Drug Info | [106] | |||
8-methoxy-4-methyl-3,4-dihydroquinazolin-2-amine | Drug Info | [132] | |||
8-Methoxy-quinolin-2-ylamine | Drug Info | [106] | |||
9-Methoxy-1,2,3,4-tetrahydro-anthracen-2-ylamine | Drug Info | [126] | |||
A-80426 | Drug Info | [133] | |||
A-987306 | Drug Info | [134] | |||
AGROCLAVINE | Drug Info | [135] | |||
BMY-7378 | Drug Info | [136] | |||
Brolamfetamine | Drug Info | [109] | |||
CHLOROPHENYLPIPERAZINE | Drug Info | [112] | |||
CP-293019 | Drug Info | [137] | |||
ESCHOLTZINE | Drug Info | [138] | |||
Etisulergine | Drug Info | [139] | |||
JNJ-10392980 | Drug Info | [140] | |||
LYSERGIC ACID DIETHYLAMIDE | Drug Info | [141] | |||
MAZAPERTINE | Drug Info | [142] | |||
MCL-516 | Drug Info | [105] | |||
N-(3-(1H-indol-4-yloxy)propyl)cyclohexanamine | Drug Info | [130] | |||
N-(3-(1H-indol-4-yloxy)propyl)cyclopentanamine | Drug Info | [130] | |||
N-Benzyl-4-(2-diphenyl)-1-piperazinehexanamide | Drug Info | [143] | |||
N-methyllaurotetanine | Drug Info | [138] | |||
N-[4-(4-Phenyl-piperazin-1-yl)-butyl]-benzamide | Drug Info | [144] | |||
PB-28 | Drug Info | [145] | |||
PG-01037 | Drug Info | [146] | |||
PHENYLPIPERAZINE | Drug Info | [106] | |||
QUIPAZINE | Drug Info | [147] | |||
SB-271046 | Drug Info | [148] | |||
SB-656104 | Drug Info | [149] | |||
SEROTONIN | Drug Info | [147] | |||
SNAP-8719 | Drug Info | [150] | |||
SPIPERONE | Drug Info | [151] | |||
Sunepitron | Drug Info | [102] | |||
TERTATOLOL | Drug Info | [126] | |||
TIOSPIRONE | Drug Info | [152] | |||
UH-232 | Drug Info | [153] | |||
UH-301 | Drug Info | [154] | |||
WAY-466 | Drug Info | [155] | |||
WB-4101 | Drug Info | [151] | |||
Antagonist | (R)-flurocarazolol | Drug Info | [156] | ||
(S)-flurocarazolol | Drug Info | [156] | |||
(S)-UH-301 | Drug Info | [157] | |||
(S)-WAY 100135 | Drug Info | [157] | |||
9-OH-risperidone | Drug Info | [158] | |||
AV-965 | Drug Info | [159] | |||
BINOSPIRONE MESYLATE | Drug Info | [160], [8] | |||
cyamemazine | Drug Info | [161] | |||
DSP-1053 | Drug Info | [162] | |||
DU 125530 | Drug Info | [163] | |||
GR 125,743 | Drug Info | [164] | |||
GSK-958108 | Drug Info | [165] | |||
GSK163090 | Drug Info | [166] | |||
LECOZOTAN HYDROCHLORIDE | Drug Info | [167], [8] | |||
LY433221 | Drug Info | [168] | |||
MIN-117 | Drug Info | [169] | |||
MPDT | Drug Info | [170] | |||
NAN-190 | Drug Info | [157] | |||
ORG-13011 | Drug Info | [171], [8] | |||
P-MPPI | Drug Info | [157], [172] | |||
p-[18F]MPPF | Drug Info | [173] | |||
PD-158771 | Drug Info | [31] | |||
REC-15/3079 | Drug Info | [174] | |||
repinotan | Drug Info | [175] | |||
Robalzotan | Drug Info | [176] | |||
RP5063 | Drug Info | [177], [178] | |||
S-15535 | Drug Info | [179], [8] | |||
SB 272183 | Drug Info | [180] | |||
SB 649915 | Drug Info | [181] | |||
SB 714786 | Drug Info | [181] | |||
SDZ 216-525 | Drug Info | [157] | |||
SLV-307 | Drug Info | [182] | |||
TGWOOAA | Drug Info | [183] | |||
Treximet | Drug Info | [166] | |||
Umespirone | Drug Info | [184] | |||
WAY 100135 | Drug Info | [157] | |||
WAY-100635 | Drug Info | [185], [186], [163] | |||
Xaliproden | Drug Info | [187] | |||
[11C]WAY100635 | Drug Info | [188] | |||
[3H]p-MPPF | Drug Info | [189] | |||
[3H]robalzotan | Drug Info | [190] | |||
[3H]WAY100635 | Drug Info | [191] | |||
Agonist | 1-naphthylpiperazine | Drug Info | [117] | ||
1192U90 | Drug Info | [31] | |||
5-CT | Drug Info | [164] | |||
7-methoxy-1-naphthylpiperazine | Drug Info | [117] | |||
A-74283 | Drug Info | [192] | |||
Adatanserin | Drug Info | [193], [21] | |||
ALNESPIRONE | Drug Info | [194], [8] | |||
AP-521 | Drug Info | [195], [8] | |||
BRL-15572 | Drug Info | [196] | |||
Buspirone | Drug Info | [197] | |||
CM-2236 | Drug Info | [198] | |||
CM-2395 | Drug Info | [199] | |||
CP 93129 | Drug Info | [164] | |||
Dual norepinephrine reuptake inhibitors/5-HT1A partial agonists | Drug Info | [200] | |||
Ebalzotan | Drug Info | [201] | |||
Eltoprazine | Drug Info | [202] | |||
EMDT | Drug Info | [170] | |||
Eptapirone | Drug Info | [203] | |||
FG-5893 | Drug Info | [204] | |||
Flesinoxan | Drug Info | [205] | |||
Gepirone ER | Drug Info | [21] | |||
GR-127607 | Drug Info | [206] | |||
Ipsapirone | Drug Info | [207] | |||
L-772,405 | Drug Info | [208] | |||
LESOPITRON DIHYDROCHLORIDE | Drug Info | [209] | |||
LP-12 | Drug Info | [210] | |||
LP-211 | Drug Info | [143] | |||
LP-44 | Drug Info | [210] | |||
LY 165,163 | Drug Info | [204] | |||
LY-293284 | Drug Info | [211] | |||
MN-305 | Drug Info | [21] | |||
nafadotride | Drug Info | [204] | |||
Nerisopam | Drug Info | [212] | |||
Neu-P11 | Drug Info | [213] | |||
piribedil | Drug Info | [214] | |||
S-14671 | Drug Info | [215] | |||
SB 216641 | Drug Info | [196] | |||
spiroxatrine | Drug Info | [204] | |||
SUN N4057 | Drug Info | [216] | |||
SUN-8399 | Drug Info | [217] | |||
U-93385 | Drug Info | [218], [8] | |||
U92016A | Drug Info | [219] | |||
Urapidil | Drug Info | [220] | |||
Zalospirone | Drug Info | [36] | |||
[3H]8-OH-DPAT | Drug Info | [221] | |||
[3H]NLX-112 | Drug Info | [222] | |||
[3H]S-15535 | Drug Info | [215] | |||
Modulator | Anpirtoline | Drug Info | [76] | ||
Bifeprunox | Drug Info | ||||
BMS-181100 | Drug Info | ||||
CGS-18102A | Drug Info | [223] | |||
CGS-19480A | Drug Info | [224], [8] | |||
Du-123015 | Drug Info | [225] | |||
DU-29894 | Drug Info | [226] | |||
E2101 | Drug Info | [227] | |||
EMD 56551 | Drug Info | ||||
Ensaculin hydrochloride | Drug Info | [18] | |||
Flibanserin | Drug Info | [3] | |||
HT-90B | Drug Info | [228] | |||
Mazapertine succinate | Drug Info | ||||
NLX-101 | Drug Info | ||||
NPT-500 | Drug Info | [200] | |||
OPC-14523 | Drug Info | [229] | |||
OPC-34712 | Drug Info | ||||
PRX-00023 | Drug Info | ||||
RWJ-25730 | Drug Info | ||||
S-14506 | Drug Info | ||||
S-16924 | Drug Info | [27], [28] | |||
Sarizotan | Drug Info | ||||
SDZ-MAR-327 | Drug Info | ||||
SEL-73 | Drug Info | [200] | |||
SKL-PSY | Drug Info | [200] | |||
SLV-313 | Drug Info | ||||
SR-59026 | Drug Info | ||||
SSR-181507 | Drug Info | ||||
TGBA01AD | Drug Info | ||||
TGFK08AA-ER | Drug Info | [230] | |||
TGFK09SD-ER | Drug Info | [231] | |||
Trazodone | Drug Info | [232] | |||
Vilazodone | Drug Info | [12] | |||
Binder | BTS-79018 | Drug Info | [31] | ||
Modulator (allosteric modulator) | RS-30199 | Drug Info | [233] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | cAMP signaling pathway | ||||
Neuroactive ligand-receptor interaction | |||||
Serotonergic synapse | |||||
PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | ||||
5HT1 type receptor mediated signaling pathway | |||||
Reactome | Serotonin receptors | ||||
G alpha (i) signalling events | |||||
WikiPathways | Serotonin HTR1 Group and FOS Pathway | ||||
SIDS Susceptibility Pathways | |||||
Monoamine GPCRs | |||||
GPCRs, Class A Rhodopsin-like | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
REF 1 | Glutamate and anxiety disorders. Curr Psychiatry Rep. 2007 Aug;9(4):278-83. | ||||
REF 2 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 36). | ||||
REF 3 | 2013 FDA drug approvals. Nat Rev Drug Discov. 2014 Feb;13(2):85-9. | ||||
REF 4 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8182). | ||||
REF 5 | ClinicalTrials.gov (NCT01397786) Safety and Tolerability Study of Oral OPC-34712 as Maintenance Treatment in Adults With Schizophrenia. U.S. National Institutes of Health. | ||||
REF 6 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7672). | ||||
REF 7 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 64). | ||||
REF 8 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
REF 9 | Emerging treatments for depression. Expert Opin Pharmacother. 2006 Dec;7(17):2323-39. | ||||
REF 10 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 213). | ||||
REF 11 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 021926. | ||||
REF 12 | 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4. | ||||
REF 13 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7427). | ||||
REF 14 | Pharmaceutical Research Companies Are Developing More Than 300 Medicines to Treat Mental Illnesses. Pharmaceutical Research and Manufacturers of America report.2010. | ||||
REF 15 | Designing drugs for the treatment of female sexual dysfunction. Drug Discov Today. 2007 Sep;12(17-18):757-66. Epub 2007 Aug 27. | ||||
REF 16 | ClinicalTrials.gov (NCT00277810) Study Evaluating the Safety, Tolerability, and Efficacy of Lecozotan SR in Outpatients With Alzheimer's Disease. U.S. National Institutes of Health. | ||||
REF 17 | ClinicalTrials.gov (NCT01266174) Effects of Eltoprazine on Cognitive Impairment Associated With Schizophrenia (CIAS) in Adults. U.S. National Institutes of Health. | ||||
REF 18 | Ensaculin (KA-672 HCl): a multitransmitter approach to dementia treatment. CNS Drug Rev. 2002 Summer;8(2):143-58. | ||||
REF 19 | Orally active benzamide antipsychotic agents with affinity for dopamine D2, serotonin 5-HT1A, and adrenergic alpha1 receptors. J Med Chem. 1998 Jun 4;41(12):1997-2009. | ||||
REF 20 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800037483) | ||||
REF 21 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2. | ||||
REF 22 | ClinicalTrials.gov (NCT01489969) Sleep Laboratory Study to Investigate the Safety and Efficacy of Neu-P11 in Primary Insomnia Patients. U.S. National Institutes of Health. | ||||
REF 23 | ClinicalTrials.gov (NCT00000189) Gepirone vs Placebo in Treatment of Cocaine Dependence - 3. U.S. National Institutes of Health. | ||||
REF 24 | ClinicalTrials.gov (NCT01490086) RP5063 in Subjects With Schizophrenia or Schizoaffective Disorder. U.S. National Institutes of Health. | ||||
REF 25 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 26). | ||||
REF 26 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002186) | ||||
REF 27 | S-16924 [(R)-2-[1-[2-(2,3-dihydro-benzo[1,4]dioxin-5-yloxy)-ethyl]- pyrrolidin-3yl]-1-(4-fluorophenyl)-ethanone], a novel, potential antipsychotic with marked serotonin1A agonist properties: III. Anxiolytic actions in comparison with clozapine and haloperidol. J Pharmacol Exp Ther. 1999 Mar;288(3):1002-14. | ||||
REF 28 | S 16924 ((R)-2-[1-[2-(2,3-dihydro-benzo[1,4] dioxin-5-Yloxy)-ethyl]-pyrrolidin-3yl]-1-(4-fluoro-phenyl)-ethanone), a novel, potential antipsychotic with marked serotonin (5-HT)1A agonist properties: I. Receptorial and neurochemical profile in comparison with clozapine and haloperidol. J Pharmacol Exp Ther. 1998 Sep;286(3):1341-55. | ||||
REF 29 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 167). | ||||
REF 30 | Positron emission tomographic analysis of central dopamine D1 receptor binding in normal subjects treated with the atypical neuroleptic, SDZ MAR 327. Int J Mol Med. 1998 Jan;1(1):243-7. | ||||
REF 31 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. | ||||
REF 32 | ClinicalTrials.gov (NCT00272909) Efficacy of SUN N4057 in Subjects With Acute Ischemic Stroke and Measurable Penumbra on Magnetic Resonance Imaging (MRI). U.S. National Institutes of Health. | ||||
REF 33 | Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals. | ||||
REF 34 | Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals. | ||||
REF 35 | Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals. | ||||
REF 36 | The serotonin 5-HT?? receptor agonist tandospirone improves executive function in common marmosets. Behav Brain Res. 2015 Jul 1;287:120-6. | ||||
REF 37 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 58). | ||||
REF 38 | 1192U90 in animal tests that predict antipsychotic efficacy, anxiolysis, and extrapyramidal side effects. Neuropsychopharmacology. 1996 Sep;15(3):231-42. | ||||
REF 39 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025412) | ||||
REF 40 | ClinicalTrials.gov (NCT01774747) A Multiple Ascending Oral Dose Evaluation of the Safety, Tolerability, and Pharmacokinetics of DSP-1053 and Its Metabolites in Healthy Subjects and in Subjects With Major Depressive Disorder. U.S. National Institutes of Health. | ||||
REF 41 | ClinicalTrials.gov (NCT00664365) FTIH Study With GSK958108. U.S. National Institutes of Health. | ||||
REF 42 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000698) | ||||
REF 43 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029346) | ||||
REF 44 | Psychopathology and psychophysiology of minimal LSD-25 dosage; a preliminary dosage-response spectrum. AMA Arch Neurol Psychiatry. 1958 Feb;79(2):208-10. | ||||
REF 45 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 17). | ||||
REF 46 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8). | ||||
REF 47 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000679) | ||||
REF 48 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1). | ||||
REF 49 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001126) | ||||
REF 50 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004255) | ||||
REF 51 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 101). | ||||
REF 52 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000562) | ||||
REF 53 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001601) | ||||
REF 54 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001421) | ||||
REF 55 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004776) | ||||
REF 56 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014469) | ||||
REF 57 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026154) | ||||
REF 58 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001441) | ||||
REF 59 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002662) | ||||
REF 60 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 74). | ||||
REF 61 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010455) | ||||
REF 62 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 72). | ||||
REF 63 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006370) | ||||
REF 64 | Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42. | ||||
REF 65 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000677) | ||||
REF 66 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001422) | ||||
REF 67 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013610) | ||||
REF 68 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006909) | ||||
REF 69 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010848) | ||||
REF 70 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003531) | ||||
REF 71 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001415) | ||||
REF 72 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001433) | ||||
REF 73 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002172) | ||||
REF 74 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002258) | ||||
REF 75 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006017) | ||||
REF 76 | Effects of anpirtoline on regional serotonin synthesis in the rat brain: an autoradiographic study. Nucl Med Biol. 2006 Apr;33(3):325-32. Epub 2006 Mar 9. | ||||
REF 77 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 9). | ||||
REF 78 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001317) | ||||
REF 79 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001927) | ||||
REF 80 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 977). | ||||
REF 81 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008823) | ||||
REF 82 | Neither in vivo MRI nor behavioural assessment indicate therapeutic efficacy for a novel 5HT1A agonist in rat models of ischaemic stroke. BMC Neuroscience 2009, 10:82. | ||||
REF 83 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003558) | ||||
REF 84 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 42). | ||||
REF 85 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000695) | ||||
REF 86 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 19). | ||||
REF 87 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003567) | ||||
REF 88 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 73). | ||||
REF 89 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001193) | ||||
REF 90 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001430) | ||||
REF 91 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 24). | ||||
REF 92 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001368) | ||||
REF 93 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 78). | ||||
REF 94 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001469) | ||||
REF 95 | Pharmacokinetics, Pharmacodynamics and Tolerance of SLV 307 After Single Oral Administration in Healthy Male Volunteers. Clinical Pharmacology & Therapeutics. 02/1999; 65(2). | ||||
REF 96 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 79). | ||||
REF 97 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002060) | ||||
REF 98 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 80). | ||||
REF 99 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002783) | ||||
REF 100 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 499). | ||||
REF 101 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004048) | ||||
REF 102 | J Med Chem. 2006 Jun 1;49(11):3116-35.An integrated in silico 3D model-driven discovery of a novel, potent, and selective amidosulfonamide 5-HT1A agonist (PRX-00023) for the treatment of anxiety and depression. | ||||
REF 103 | J Med Chem. 1986 May;29(5):630-4.Synthesis and evaluation of phenyl- and benzoylpiperazines as potential serotonergic agents. | ||||
REF 104 | Bioorg Med Chem Lett. 2007 Aug 1;17(15):4128-30. Epub 2007 May 23.R-(-)-N-alkyl-11-hydroxy-10-hydroxymethyl- and 10-methyl-aporphines as 5-HT1A receptor ligands. | ||||
REF 105 | Bioorg Med Chem. 2008 Jul 15;16(14):6675-81. Epub 2008 Jun 5.Synthesis and pharmacological investigation of novel 2-aminothiazole-privileged aporphines. | ||||
REF 106 | J Med Chem. 1986 Nov;29(11):2375-80.5-HT1 and 5-HT2 binding characteristics of some quipazine analogues. | ||||
REF 107 | J Med Chem. 2010 Jun 24;53(12):4803-7.Discovery of bishomo(hetero)arylpiperazines as novel multifunctional ligands targeting dopamine D(3) and serotonin 5-HT(1A) and 5-HT(2A) receptors. | ||||
REF 108 | J Med Chem. 2006 Jan 12;49(1):318-28.1-((S)-2-aminopropyl)-1H-indazol-6-ol: a potent peripherally acting 5-HT2 receptor agonist with ocular hypotensive activity. | ||||
REF 109 | J Med Chem. 1986 Feb;29(2):194-9.5-HT1 and 5-HT2 binding characteristics of 1-(2,5-dimethoxy-4-bromophenyl)-2-aminopropane analogues. | ||||
REF 110 | Bioorg Med Chem Lett. 2009 Dec 1;19(23):6604-7. Epub 2009 Oct 12.Discovery and pharmacological characterization of aryl piperazine and piperidine ethers as dual acting norepinephrine reuptake inhibitors and 5-HT1A partial agonists. | ||||
REF 111 | Bioorg Med Chem Lett. 2010 Feb 1;20(3):1114-7. Epub 2009 Dec 6.Design, synthesis, and pharmacological evaluation of phenoxy pyridyl derivatives as dual norepinephrine reuptake inhibitors and 5-HT1A partial agonists. | ||||
REF 112 | J Med Chem. 1989 May;32(5):1052-6.Activity of aromatic substituted phenylpiperazines lacking affinity for dopamine binding sites in a preclinical test of antipsychotic efficacy. | ||||
REF 113 | J Med Chem. 1991 Jun;34(6):1850-4.Pyrimido[5,4-b]indole derivatives. 1. A new class of potent and selective alpha 1 adrenoceptor ligands. | ||||
REF 114 | J Med Chem. 1994 Aug 19;37(17):2754-60.Structure-activity relationship studies of central nervous system agents. 13. 4-[3-(Benzotriazol-1-yl)propyl]-1-(2-methoxyphenyl)piperazine, a new putative 5-HT1A receptor antagonist, and its analogs. | ||||
REF 115 | Bioorg Med Chem Lett. 2010 Nov 15;20(22):6628-32. Epub 2010 Sep 21.Identification of a red-emitting fluorescent ligand for in vitro visualization of human serotonin 5-HT(1A) receptors. | ||||
REF 116 | Bioorg Med Chem. 2007 Nov 1;15(21):6659-66. Epub 2007 Aug 15.The synthesis and biological activity of pentafluorosulfanyl analogs of fluoxetine, fenfluramine, and norfenfluramine. | ||||
REF 117 | J Med Chem. 1997 Nov 21;40(24):3974-8.5-HT1B receptor antagonist properties of novel arylpiperazide derivatives of 1-naphthylpiperazine. | ||||
REF 118 | J Med Chem. 2006 Nov 2;49(22):6607-13.Arylmethyloxyphenyl derivatives: small molecules displaying P-glycoprotein inhibition. | ||||
REF 119 | J Med Chem. 2005 Jan 13;48(1):266-73.Synthesis and structure-activity relationships of 1-aralkyl-4-benzylpiperidine and 1-aralkyl-4-benzylpiperazine derivatives as potent sigma ligands. | ||||
REF 120 | Bioorg Med Chem Lett. 2001 May 7;11(9):1229-31.Influence of the terminal amide fragment geometry in some 3-arylideneindolin-2(1H)-ones on their 5-HT1A/5-HT2A receptor activity. | ||||
REF 121 | Regioselective synthesis of 3-aryl substituted pyrrolidines via palladium catalyzed arylation: pharmacological evaluation for central dopaminergic and serotonergic activity, Bioorg. Med. Chem. Lett. 7(3):241-246 (1997). | ||||
REF 122 | Bioorg Med Chem Lett. 2007 Jun 1;17(11):3018-22. Epub 2007 Mar 23.Novel aminoethylbiphenyls as 5-HT7 receptor ligands. | ||||
REF 123 | Bioorg Med Chem. 2010 Mar 1;18(5):1958-67. Epub 2010 Jan 18.SAR studies on new bis-aryls 5-HT7 ligands: Synthesis and molecular modeling. | ||||
REF 124 | 4-(3-furyl)-2-(4-methylpiperazino)pyrimidines: Potent 5-HT2A receptor antagonists, Bioorg. Med. Chem. Lett. 7(13):1635-1638 (1997). | ||||
REF 125 | J Med Chem. 2003 Sep 11;46(19):4188-95.A novel and selective 5-HT2 receptor agonist with ocular hypotensive activity: (S)-(+)-1-(2-aminopropyl)-8,9-dihydropyrano[3,2-e]indole. | ||||
REF 126 | Synthesis of new derivatives of 8-OH-DPAT: Influence of substitution on the aromatic ring on the pharmacological profile, Bioorg. Med. Chem. Lett. 3(10):2035-2038 (1993). | ||||
REF 127 | J Med Chem. 1990 Aug;33(8):2087-93.3-(1,2,5,6-Tetrahydropyrid-4-yl)pyrrolo[3,2-b]pyrid-5-one: a potent and selective serotonin (5-HT1B) agonist and rotationally restricted phenolic analogue of 5-methoxy-3-(1,2,5,6-tetrahydropyrid-4-yl)indole. | ||||
REF 128 | Bioorg Med Chem Lett. 1998 Feb 3;8(3):295-300.New generation dopaminergic agents. 2. Discovery of 3-OH-phenoxyethylamine and 3-OH-N1-phenylpiperazine dopaminergic templates. | ||||
REF 129 | J Med Chem. 1992 Oct 30;35(22):3984-90.6-Hydroxy-3-n-propyl-2,3,4,5-tetrahydro-1H-3-benzazepine and analogs: new centrally acting 5-HT1A receptor agonists. | ||||
REF 130 | Bioorg Med Chem Lett. 2007 Oct 15;17(20):5600-4. Epub 2007 Aug 22.Indoloxypropanolamine analogues as 5-HT(1A) receptor antagonists. | ||||
REF 131 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
REF 132 | Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61. Epub 2007 Oct 30.Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. | ||||
REF 133 | J Med Chem. 2005 Oct 20;48(21):6523-43.Designed multiple ligands. An emerging drug discovery paradigm. | ||||
REF 134 | J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. | ||||
REF 135 | J Med Chem. 1988 Aug;31(8):1512-9.Ergolines as selective 5-HT1 agonists. | ||||
REF 136 | J Med Chem. 1996 Mar 1;39(5):1125-9.8-[4-[2-(1,2,3,4-Tetrahydroisoquinolinyl]butyl-8-azaspiro[4.5]decane-7,9-dione: a new 5-HT1A receptor ligand with the same activity profile as buspirone. | ||||
REF 137 | Bioorg Med Chem Lett. 1998 Apr 7;8(7):725-30.Synthesis, SAR and pharmacology of CP-293,019: a potent, selective dopamine D4 receptor antagonist. | ||||
REF 138 | J Nat Prod. 2006 Mar;69(3):432-5.Alkaloids from Eschscholzia californica and their capacity to inhibit binding of [3H]8-Hydroxy-2-(di-N-propylamino)tetralin to 5-HT1A receptors in Vitro. | ||||
REF 139 | J Med Chem. 1985 Oct;28(10):1540-2.Resolution and absolute configuration of the potent dopamine agonist N,N-diethyl-N'-[(3 alpha, 4a alpha, 10a beta)-1,2,3,4,4a,5,10,10a- -octahydro-6-hydroxy-1-propyl-3-benzo[g]quinolinyl]sulfamide. | ||||
REF 140 | J Med Chem. 2008 Jul 24;51(14):4150-69. Epub 2008 Jun 28.Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity. | ||||
REF 141 | J Med Chem. 1995 Mar 17;38(6):958-66.Stereoselective LSD-like activity in a series of d-lysergic acid amides of (R)- and (S)-2-aminoalkanes. | ||||
REF 142 | J Med Chem. 1994 Apr 15;37(8):1060-2.A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. | ||||
REF 143 | J Med Chem. 2008 Sep 25;51(18):5813-22.Structural modifications of N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides: influence on lipophilicity and 5-HT7 receptor activity. Part III. | ||||
REF 144 | J Med Chem. 1988 Oct;31(10):1968-71.Arylpiperazine derivatives as high-affinity 5-HT1A serotonin ligands. | ||||
REF 145 | J Med Chem. 1996 Jan 5;39(1):176-82.New sigma and 5-HT1A receptor ligands: omega-(tetralin-1-yl)-n-alkylamine derivatives. | ||||
REF 146 | J Med Chem. 2007 Aug 23;50(17):4135-46. Epub 2007 Aug 2.Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3 receptor ligands: potential substance abuse therapeutic agents. | ||||
REF 147 | J Med Chem. 2009 Nov 12;52(21):6946-50.Novel, potent, and selective quinoxaline-based 5-HT(3) receptor ligands. 1. Further structure-activity relationships and pharmacological characterization. | ||||
REF 148 | Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. Epub 2007 Nov 17.Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. | ||||
REF 149 | Bioorg Med Chem Lett. 2005 Feb 1;15(3):747-50.Novel 3-aminochromans as potential pharmacological tools for the serotonin 5-HT(7) receptor. | ||||
REF 150 | J Med Chem. 2005 Apr 21;48(8):3076-9.Synthesis and structure-activity relationship of fluoro analogues of 8-{2-[4-(4-methoxyphenyl)piperazin-1yl]ethyl}-8-azaspiro[4.5]decane-7,9-dione as selective alpha(1d)-adrenergic receptor antagonists. | ||||
REF 151 | J Med Chem. 1993 Oct 15;36(21):3161-5.Synthesis of (R,S)-trans-8-hydroxy-2-[N-n-propyl-N-(3'-iodo-2'-propenyl)amino]tetral in (trans-8-OH-PIPAT): a new 5-HT1A receptor ligand. | ||||
REF 152 | J Med Chem. 1991 Nov;34(11):3316-28.Synthesis and biological activity of the putative metabolites of the atypical antipsychotic agent tiospirone. | ||||
REF 153 | (Dipropylamino)-tetrahydronaphthofurans: centrally acting serotonin agonists and dopamine agonists-antagonists, Bioorg. Med. Chem. Lett. 7(21):2759-2764 (1997). | ||||
REF 154 | J Med Chem. 1997 Apr 11;40(8):1252-7.N-[2-[(substituted chroman-8-yl)oxy]ethyl]-4-(4-methoxyphenyl)butylamines: synthesis and wide range of antagonism at the human 5-HT1A receptor. | ||||
REF 155 | J Med Chem. 2005 Jan 27;48(2):353-6.Discovery of 5-arylsulfonamido-3-(pyrrolidin-2-ylmethyl)-1H-indole derivatives as potent, selective 5-HT6 receptor agonists and antagonists. | ||||
REF 156 | The in vitro pharmacology of the beta-adrenergic receptor pet ligand (s)-fluorocarazolol reveals high affinity for cloned beta-adrenergic receptors and moderate affinity for the human 5-HT1A receptor. Psychopharmacology (Berl). 2001 Aug;157(1):111-4. | ||||
REF 157 | Influence of 5-HT1A receptor antagonism on plus-maze behaviour in mice. II. WAY 100635, SDZ 216-525 and NAN-190. Pharmacol Biochem Behav. 1997 Oct;58(2):593-603. | ||||
REF 158 | Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl). 1996 Mar;124(1-2):57-73. | ||||
REF 159 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025412) | ||||
REF 160 | Quantifying the 5-HT1A agonist action of buspirone in man. Psychopharmacology (Berl). 2001 Nov;158(3):224-9. | ||||
REF 161 | Affinity of cyamemazine, an anxiolytic antipsychotic drug, for human recombinant dopamine vs. serotonin receptor subtypes. Biochem Pharmacol. 2003 Feb 1;65(3):435-40. | ||||
REF 162 | DSP-1053, a novel serotonin reuptake inhibitor with 5-HT1A partial agonistic activity, displays fast antidepressant effect with minimal undesirable effects in juvenile rats. Pharmacol Res Perspect. 2015 Jun;3(3):e00142. | ||||
REF 163 | 5-Hydroxytryptamine1A receptor occupancy by novel full antagonist 2-[4-[4-(7-chloro-2,3-dihydro-1,4-benzdioxyn-5-yl)-1-piperazinyl]butyl]-1,2-benzisothiazol-3-(2H)-one-1,1-dioxide: a[11C][O-methyl-3H]-N-(2-(4-(2-methoxyphenyl)-1-piperazinyl)ethyl)-N-(2-pyridinyl)cyclohexanecarboxamide trihydrochloride (WAY-100635) positron emission tomography study in humans. J Pharmacol Exp Ther. 2002 Jun;301(3):1144-50. | ||||
REF 164 | Agonist activity of antimigraine drugs at recombinant human 5-HT1A receptors: potential implications for prophylactic and acute therapy. Naunyn Schmiedebergs Arch Pharmacol. 1997 Jun;355(6):682-8. | ||||
REF 165 | Clinical pipeline report, company report or official report of GlaxoSmithKline. | ||||
REF 166 | Clinical pipeline report, company report or official report of GlaxoSmithKline (2009). | ||||
REF 167 | A positron emission tomography study to assess binding of lecozotan, a novel 5-hydroxytryptamine-1A silent antagonist, to brain 5-HT1A receptors in healthy young and elderly subjects, and in patientswith Alzheimer's disease. Clin Pharmacol Ther. 2008 Jan;83(1):86-96. Epub 2007 May 16. | ||||
REF 168 | Serotonin reuptake inhibitors: the corner stone in treatment of depression for half a century--a medicinal chemistry survey. Curr Top Med Chem. 2006;6(17):1801-23. | ||||
REF 169 | Company report (Minerva Neurosciences),MIN-101,Schizophrenia, 6 trials completed; Once a day formulation completed , Phase IIa completed; Phase IIb enrollment ongoing and expected to continue over the last 3 quarters of 2015. | ||||
REF 170 | 2-Substituted tryptamines: agents with selectivity for 5-HT(6) serotonin receptors. J Med Chem. 2000 Mar 9;43(5):1011-8. | ||||
REF 171 | Antagonism of the 5-HT1A receptor stimulus in a conditioned taste aversion procedure. Eur Neuropsychopharmacol. 1999 Jun;9(4):345-9. | ||||
REF 172 | p-Chloroamphetamine, a serotonin-releasing drug, elicited in rats a hyperglycemia mediated by the 5-HT1A and 5-HT2B/2C receptors. Eur J Pharmacol. 1998 Oct 23;359(2-3):185-90. | ||||
REF 173 | A 18F-MPPF PET normative database of 5-HT1A receptor binding in men and women over aging. J Nucl Med. 2005 Dec;46(12):1980-9. | ||||
REF 174 | N-[2-[4-(2-methoxyphenyl)-1-piperazinyl]ethyl]-N-(2-nitrophenyl) cyclohexanecarboxamide: a novel pre- and postsynaptic 5-hydroxytryptamine(1A) receptor antagonist active on the lower urinary tract. JPharmacol Exp Ther. 2001 Dec;299(3):1027-37. | ||||
REF 175 | Characterization of the aminomethylchroman derivative BAY x 3702 as a highly potent 5-hydroxytryptamine1A receptor agonist. J Pharmacol Exp Ther. 1998 Mar;284(3):1082-94. | ||||
REF 176 | Use of PET and the radioligand [carbonyl-(11)C]WAY-100635 in psychotropic drug development. Nucl Med Biol. 2000 Jul;27(5):515-21. | ||||
REF 177 | Drug Development in Schizophrenia: Summary and Table. Pharmaceutical Medicine October 2014, Volume 28, Issue 5, pp 265-271 | ||||
REF 178 | EFFICACY AND SAFETY OF NOVEL DOPAMINE SEROTONIN STABILIZER RP 5063 IN ACUTE SCHIZOPHRENIA AND SCHIZOAFFECTIVE DISORDER. Schizophrenia Research Volume 153, Supplement 1, April 2014, Pages S22. | ||||
REF 179 | S 15535, a benzodioxopiperazine acting as presynaptic agonist and postsynaptic 5-HT1A receptor antagonist, prevents the impairment of spatial learning caused by intrahippocampal scopolamine. Br J Pharmacol. 1999 Nov;128(6):1207-14. | ||||
REF 180 | SB-272183, a selective 5-HT(1A), 5-HT(1B) and 5-HT(1D) receptor antagonist in native tissue. Br J Pharmacol. 2001 Jul;133(6):797-806. | ||||
REF 181 | Discovery of the first potent, selective 5-hydroxytryptamine1D receptor antagonist. J Med Chem. 2005 May 19;48(10):3478-80. | ||||
REF 182 | Development and validation of a capillary electrophoresis method for the enantiomeric purity determination of SLV307, a basic potential antipsychotic compound. Electrophoresis. 2004 Aug;25(16):2854-9. | ||||
REF 183 | Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals. | ||||
REF 184 | The effects of umespirone as a potential anxiolytic and antipsychotic agent. Pharmacol Biochem Behav. 1991 Sep;40(1):89-96. | ||||
REF 185 | Involvement of 5-hydroxytryptamine(1A) receptors in nicotine-induced tail tremor in rats. Eur J Pharmacol. 2000 Nov 10;408(1):19-23. | ||||
REF 186 | Cocaine and serotonin: a role for the 5-HT(1A) receptor site in the mediation of cocaine stimulant effects. Behav Brain Res. 2001 Nov 29;126(1-2):127-33. | ||||
REF 187 | Pharma & Vaccines. Product Development Pipeline. April 29 2009. | ||||
REF 188 | [11C]-WAY100635 PET demonstrates marked 5-HT1A receptor changes in sporadic ALS. Brain. 2005 Apr;128(Pt 4):896-905. Epub 2005 Feb 2. | ||||
REF 189 | Ligand binding characteristics of the human serotonin1A receptor heterologously expressed in CHO cells. Biosci Rep. 2004 Apr;24(2):101-15. | ||||
REF 190 | Receptor binding characteristics of [3H]NAD-299, a new selective 5-HT1A receptor antagonist. Eur J Pharmacol. 1998 Nov 6;360(2-3):219-25. | ||||
REF 191 | Pharmacological characterization of recombinant human 5-hydroxytryptamine1A receptors using a novel antagonist radioligand, [3H]WAY-100635. Life Sci. 1997;60(9):653-65. | ||||
REF 192 | Cardiovascular activity of A-74283, a 5-hydroxytryptamine 1A agent, in the spontaneously hypertensive rat. Pharmacology. 1998 Jan;56(1):17-29. | ||||
REF 193 | Synthesis and SAR of adatanserin: novel adamantyl aryl- and heteroarylpiperazines with dual serotonin 5-HT(1A) and 5-HT(2) activity as potential anxiolytic and antidepressant agents. J Med Chem. 1999Dec 16;42(25):5077-94. | ||||
REF 194 | Chronic alnespirone-induced desensitization of somatodendritic 5-HT1A autoreceptors in the rat dorsal raphe nucleus. Eur J Pharmacol. 1999 Jan 22;365(2-3):165-73. | ||||
REF 195 | The effects of AP521, a novel anxiolytic drug, in three anxiety models and on serotonergic neural transmission in rats. J Pharmacol Sci. 2015 Jan;127(1):109-16. | ||||
REF 196 | SB-216641 and BRL-15572--compounds to pharmacologically discriminate h5-HT1B and h5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1997 Sep;356(3):312-20. | ||||
REF 197 | Interactions between corticotropin-releasing hormone and serotonin: implications for the aetiology and treatment of anxiety disorders. Handb Exp Pharmacol. 2005;(169):181-204. | ||||
REF 198 | CN patent application no. 104151292, Indole derivative or a pharmaceutically acceptable salt thereof. | ||||
REF 199 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031127) | ||||
REF 200 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1). | ||||
REF 201 | The pharmacological profile of (R)-3,4-dihydro-N-isopropyl-3-(N-isopropyl-N-propylamino)-2H-1-benzopyran-5-carboxamide, a selective 5-hydroxytryptamine(1A) receptor agonist. J Pharmacol Exp Ther. 2001 Dec;299(3):883-93. | ||||
REF 202 | Clinical pipeline report, company report or official report of Jazz Pharmaceuticals. | ||||
REF 203 | The use of sleep measures to compare a new 5HT1A agonist with buspirone in humans. J Psychopharmacol. 2005 Nov;19(6):609-13. | ||||
REF 204 | Agonist and antagonist actions of antipsychotic agents at 5-HT1A receptors: a [35S]GTPgammaS binding study. Eur J Pharmacol. 1998 Aug 21;355(2-3):245-56. | ||||
REF 205 | Effect of sustained administration of the 5-HT1A receptor agonist flesinoxan on rat 5-HT neurotransmission. Eur Neuropsychopharmacol. 1999 Sep;9(5):427-40. | ||||
REF 206 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003531) | ||||
REF 207 | Chronic voluntary ethanol intake hypersensitizes 5-HT(1A) autoreceptors in C57BL/6J mice. J Neurochem. 2008 Dec;107(6):1660-70. | ||||
REF 208 | 3-[3-(Piperidin-1-yl)propyl]indoles as highly selective h5-HT(1D) receptor agonists. J Med Chem. 1999 Dec 2;42(24):4981-5001. | ||||
REF 209 | Effect of acute administration of the 5-HT1A receptor ligand, lesopitron, on rat cortical 5-HT and dopamine turnover. Br J Pharmacol. 1994 Oct;113(2):425-30. | ||||
REF 210 | Structure-activity relationship study on N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides, a class of 5-HT7 receptor agents. 2. J Med Chem. 2007 Aug 23;50(17):4214-21. Epub 2007 Jul 25. | ||||
REF 211 | Pharmacological characterization of LY293284: A 5-HT1A receptor agonist with high potency and selectivity. J Pharmacol Exp Ther. 1994 Sep;270(3):1270-81. | ||||
REF 212 | Simultaneous determination of nerisopam, a novel anxiolytic agent showing polymorphic metabolism, and its N-acetyl metabolite from human plasma by a validated high performance liquid chromatographic method. J Chromatogr B Biomed Appl. 1996 Mar 29;678(1):63-72. | ||||
REF 213 | Clinical pipeline report, company report or official report of Neurim Pharmaceuticals. | ||||
REF 214 | Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther. 2002 Nov;303(2):791-804. | ||||
REF 215 | Labelling of recombinant human and native rat serotonin 5-HT1A receptors by a novel, selective radioligand, [3H]-S 15535: definition of its binding profile using agonists, antagonists and inverse agonists. Naunyn Schmiedebergs Arch Pharmacol. 1998 Mar;357(3):205-17. | ||||
REF 216 | Experimental study of pharmacological hypothermia: enhanced neuroprotective effect of a novel 5-HT 1 A agonist SUN N4057 by the pharmacological hypothermia. No To Shinkei. 2001 Sep;53(9):853-8. | ||||
REF 217 | Effects of SUN 8399, a potent and selective 5-HT1A agonist, on conflict behavior and ambulatory activity in mice: comparison with those of buspirone, tandospirone and diazepam. Jpn J Pharmacol. 1994 Apr;64(4):273-80. | ||||
REF 218 | Tolerance development to the vagal-mediated bradycardia produced by 5-HT1A receptor agonists. J Pharmacol Exp Ther. 1994 Nov;271(2):776-81. | ||||
REF 219 | Characterization of U-92016A as a selective, orally active, high intrinsic activity 5-hydroxytryptamine1A agonist. J Pharmacol Exp Ther. 1994 Nov;271(2):875-83. | ||||
REF 220 | Urapidil. A reappraisal of its use in the management of hypertension. Drugs. 1998 Nov;56(5):929-55. | ||||
REF 221 | Effect of ring fluorination on the pharmacology of hallucinogenic tryptamines. J Med Chem. 2000 Nov 30;43(24):4701-10. | ||||
REF 222 | [(3)H]-F13640, a novel, selective and high-efficacy serotonin 5-HT(1A) receptor agonist radioligand. Naunyn Schmiedebergs Arch Pharmacol. 2010 Oct;382(4):321-30. | ||||
REF 223 | Quantitative determination of CGS 18102A, a new anxiolytic, in human plasma using capillary gas chromatography/mass spectrometry. Biomed Chromatogr. 1992 Sep-Oct;6(5):244-7. | ||||
REF 224 | WO patent application no. 2012,0025,83, Method for treating schizophrenia and related diseases with a combination therapy. | ||||
REF 225 | Neither in vivo MRI nor behavioural assessment indicate therapeutic efficacy for a novel 5HT1A agonist in rat models of ischaemic stroke. BMC Neuroscience 2009, 10:82. | ||||
REF 226 | A comparison of the neuro-endocrinological and temperature effects of DU 29894, flesinoxan, sulpiride and haloperidol in normal volunteers. Br J Clin Pharmacol. 1995 Jan;39(1):7-14. | ||||
REF 227 | In vitro interactions between a potential muscle relaxant E2101 and human cytochromes P450. Drug Metab Dispos. 2002 Jul;30(7):805-13. | ||||
REF 228 | Pharmacological profile of (-)HT-90B, a novel 5-HT1A receptor agonist/5-HT2 receptor antagonist. Prog Neuropsychopharmacol Biol Psychiatry. 1995 Nov;19(7):1201-16. | ||||
REF 229 | Antidepressant-like responses to the combined sigma and 5-HT1A receptor agonist OPC-14523. Neuropharmacology. 2001 Dec;41(8):976-88. | ||||
REF 230 | 50 years of hurdles and hope in anxiolytic drug discovery. Nat Rev Drug Discov. 2013 Sep;12(9):667-87. doi: 10.1038/nrd4075. | ||||
REF 231 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032503) | ||||
REF 232 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | ||||
REF 233 | Interaction of the anxiogenic agent, RS-30199, with 5-HT1A receptors: modulation of sexual activity in the male rat. Neuropharmacology. 1998 Jun;37(6):769-80. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.