Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T83813
(Former ID: TTDS00105)
|
|||||
Target Name |
5-HT 2C receptor (HTR2C)
|
|||||
Synonyms |
Serotonin receptor 2C; HTR1C; 5HT-1C; 5-hydroxytryptamine receptor 2C; 5-hydroxytryptamine receptor 1C; 5-HTR2C; 5-HT2C receptor; 5-HT2C; 5-HT1C; 5-HT-2C; 5-HT-1C
|
|||||
Gene Name |
HTR2C
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 5 Target-related Diseases | + | ||||
1 | Depression [ICD-11: 6A70-6A7Z] | |||||
2 | Migraine [ICD-11: 8A80] | |||||
3 | Obesity [ICD-11: 5B80-5B81] | |||||
4 | Pain [ICD-11: MG30-MG3Z] | |||||
5 | Pituitary gland disorder [ICD-11: 5A60-5A61] | |||||
Function |
Functions as a receptor for various drugs and psychoactive substances, including ergot alkaloid derivatives, 1-2,5,-dimethoxy-4-iodophenyl-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and down-stream signaling cascades and promotes the release of Ca(2+) ions from intracellular stores. Regulates neuronal activity via the activation of short transient receptor potential calcium channels in the brain, and thereby modulates the activation of pro-opiomelacortin neurons and the release of CRH that then regulates the release of corticosterone. Plays a role in the regulation of appetite and eating behavior, responses to anxiogenic stimuli and stress. Plays a role in insulin sensitivity and glucose homeostasis. G-protein coupled receptor for 5-hydroxytryptamine (serotonin).
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T83COK |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 6 Approved Drugs | + | ||||
1 | Lorcaserin | Drug Info | Approved | Obesity | [2], [3] | |
2 | Metergolin | Drug Info | Approved | Hyperprolactinaemia | [4] | |
3 | Methysergide | Drug Info | Approved | Migraine | [5], [6] | |
4 | Mirtazapine | Drug Info | Approved | Depression | [7], [8] | |
5 | Nefazodone | Drug Info | Approved | Major depressive disorder | [4] | |
6 | Tramadol | Drug Info | Approved | Pain | [9], [10] | |
Clinical Trial Drug(s) | [+] 9 Clinical Trial Drugs | + | ||||
1 | Eltoprazine | Drug Info | Phase 3 | Attention deficit hyperactivity disorder | [11] | |
2 | M100907 | Drug Info | Phase 3 | Sleep-wake disorder | [12] | |
3 | SR46349B | Drug Info | Phase 3 | Schizophrenia | [13] | |
4 | ATHX-105 | Drug Info | Phase 2 | Obesity | [14] | |
5 | Nuplazid | Drug Info | Phase 2 | Alzheimer disease | [15] | |
6 | PRX00933 | Drug Info | Phase 2 | Diabetic complication | [16] | |
7 | Puerarin | Drug Info | Phase 2 | Alcohol dependence | [17] | |
8 | Vabicaserin | Drug Info | Phase 2 | Psychotic disorder | [18] | |
9 | Tedatioxetine | Drug Info | Phase 1 | Major depressive disorder | [19] | |
Discontinued Drug(s) | [+] 8 Discontinued Drugs | + | ||||
1 | Deramciclane | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [20], [21] | |
2 | Ritanserin | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [22], [23] | |
3 | MCPP | Drug Info | Discontinued in Phase 2 | Mood disorder | [24] | |
4 | R-1065 | Drug Info | Discontinued in Phase 1 | Obesity | [25] | |
5 | SB-247853 | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [26] | |
6 | ICI-169369 | Drug Info | Terminated | Anxiety disorder | [27], [28] | |
7 | Org-37684 | Drug Info | Terminated | Anxiety disorder | [29], [30] | |
8 | SDZ-SER-082 | Drug Info | Terminated | Neurological disorder | [31], [32] | |
Mode of Action | [+] 4 Modes of Action | + | ||||
Agonist | [+] 56 Agonist drugs | + | ||||
1 | Lorcaserin | Drug Info | [33], [34] | |||
2 | ATHX-105 | Drug Info | [46] | |||
3 | Nuplazid | Drug Info | [47] | |||
4 | PRX00933 | Drug Info | [16] | |||
5 | Aryl piperazine derivative 10 | Drug Info | [52] | |||
6 | Aryl piperazine derivative 8 | Drug Info | [52] | |||
7 | Aryl piperazine derivative 9 | Drug Info | [52] | |||
8 | Benzazepine derivative 1 | Drug Info | [52] | |||
9 | Benzazepine derivative 2 | Drug Info | [52] | |||
10 | Benzazepine derivative 3 | Drug Info | [52] | |||
11 | Benzazepine derivative 4 | Drug Info | [52] | |||
12 | Benzazepine derivative 5 | Drug Info | [52] | |||
13 | Benzazepine derivative 6 | Drug Info | [52] | |||
14 | Chromene derivative 1 | Drug Info | [52] | |||
15 | Heteroaryl-azepine derivative 1 | Drug Info | [52] | |||
16 | Heteroaryl-azepine derivative 10 | Drug Info | [52] | |||
17 | Heteroaryl-azepine derivative 11 | Drug Info | [52] | |||
18 | Heteroaryl-azepine derivative 12 | Drug Info | [52] | |||
19 | Heteroaryl-azepine derivative 13 | Drug Info | [52] | |||
20 | Heteroaryl-azepine derivative 14 | Drug Info | [52] | |||
21 | Heteroaryl-azepine derivative 15 | Drug Info | [52] | |||
22 | Heteroaryl-azepine derivative 2 | Drug Info | [52] | |||
23 | Heteroaryl-azepine derivative 3 | Drug Info | [52] | |||
24 | Heteroaryl-azepine derivative 4 | Drug Info | [52] | |||
25 | Heteroaryl-azepine derivative 5 | Drug Info | [52] | |||
26 | Heteroaryl-azepine derivative 6 | Drug Info | [52] | |||
27 | Heteroaryl-azepine derivative 7 | Drug Info | [52] | |||
28 | Heteroaryl-azepine derivative 8 | Drug Info | [52] | |||
29 | Heteroaryl-azepine derivative 9 | Drug Info | [52] | |||
30 | PMID26609882-Compound-83 | Drug Info | [52] | |||
31 | Quinoline derivative 2 | Drug Info | [52] | |||
32 | Tricyclic pyrrolidine derivative 1 | Drug Info | [52] | |||
33 | Tricyclic pyrrolidine derivative 2 | Drug Info | [52] | |||
34 | Tricyclic pyrrolidine derivative 3 | Drug Info | [52] | |||
35 | Tricyclic pyrrolidine derivative 4 | Drug Info | [52] | |||
36 | MCPP | Drug Info | [60], [4] | |||
37 | R-1065 | Drug Info | [61] | |||
38 | SB-247853 | Drug Info | [62], [4] | |||
39 | Org-37684 | Drug Info | [67] | |||
40 | 5-CT | Drug Info | [78] | |||
41 | AL-37350A | Drug Info | [81] | |||
42 | alpha-methyl-5-HT | Drug Info | [82] | |||
43 | BRL-15572 | Drug Info | [84] | |||
44 | BW723C86 | Drug Info | [86] | |||
45 | CP-809101 | Drug Info | [88] | |||
46 | CSC-500297 | Drug Info | [88] | |||
47 | m-chlorophenylpiperazine | Drug Info | [93] | |||
48 | METHYLENEDIOXYMETHAMPHETAMINE | Drug Info | [94] | |||
49 | Org 12962 | Drug Info | [35] | |||
50 | SB 216641 | Drug Info | [84] | |||
51 | SB 243213 | Drug Info | [106] | |||
52 | TFMPP | Drug Info | [78] | |||
53 | TQ-1017 | Drug Info | [4] | |||
54 | WAY-163909 | Drug Info | [110] | |||
55 | [125I]DOI | Drug Info | [82] | |||
56 | [3H]LSD | Drug Info | [88] | |||
Antagonist | [+] 29 Antagonist drugs | + | ||||
1 | Metergolin | Drug Info | [35] | |||
2 | Methysergide | Drug Info | [1], [36], [37], [38] | |||
3 | Mirtazapine | Drug Info | [39], [40] | |||
4 | Nefazodone | Drug Info | [40], [41] | |||
5 | Eltoprazine | Drug Info | [43] | |||
6 | PMID26609882-Compound-58 | Drug Info | [52] | |||
7 | Pyrimidine derivative 23 | Drug Info | [52] | |||
8 | Pyrimidine derivative 24 | Drug Info | [52] | |||
9 | Pyrimidine derivative 25 | Drug Info | [52] | |||
10 | Pyrimidine derivative 26 | Drug Info | [52] | |||
11 | Pyrimidine derivative 27 | Drug Info | [52] | |||
12 | Pyrimidine derivative 28 | Drug Info | [52] | |||
13 | Pyrimidine derivative 29 | Drug Info | [52] | |||
14 | Ritanserin | Drug Info | [56], [57], [58], [59] | |||
15 | LY53857 | Drug Info | [38], [64], [65], [66] | |||
16 | BVT 933 | Drug Info | [85] | |||
17 | cyamemazine | Drug Info | [89] | |||
18 | EGIS-7625 | Drug Info | [90] | |||
19 | FR260010 | Drug Info | [91] | |||
20 | LY334362 | Drug Info | [92] | |||
21 | MPDT | Drug Info | [97] | |||
22 | norfluoxetine | Drug Info | [99] | |||
23 | SB 204741 | Drug Info | [35] | |||
24 | SB 215505 | Drug Info | [103] | |||
25 | SB 221284 | Drug Info | [35] | |||
26 | SB 228357 | Drug Info | [104] | |||
27 | SB 242084 | Drug Info | [105] | |||
28 | spiramide | Drug Info | [35] | |||
29 | [3H]mesulergine | Drug Info | [82] | |||
Modulator | [+] 9 Modulator drugs | + | ||||
1 | Tramadol | Drug Info | [42] | |||
2 | SR46349B | Drug Info | [45] | |||
3 | Puerarin | Drug Info | [48] | |||
4 | Vabicaserin | Drug Info | [49], [50] | |||
5 | Tedatioxetine | Drug Info | [51] | |||
6 | Deramciclane | Drug Info | [53], [54], [55] | |||
7 | ICI-169369 | Drug Info | [63] | |||
8 | SDZ-SER-082 | Drug Info | [69] | |||
9 | MK-212 | Drug Info | [95], [96] | |||
Inhibitor | [+] 77 Inhibitor drugs | + | ||||
1 | M100907 | Drug Info | [44] | |||
2 | Ro-60-0175 | Drug Info | [68] | |||
3 | (+/-)-nantenine | Drug Info | [70] | |||
4 | (2S)-1-(1H-furo[2,3-g]indazol-1-yl)propan-2-amine | Drug Info | [68] | |||
5 | (2S)-1-(5-fluoro-1H-indazol-1-yl)propan-2-amine | Drug Info | [68] | |||
6 | (2S)-1-(6-fluoro-1H-indazol-1-yl)propan-2-amine | Drug Info | [68] | |||
7 | (2S)-1-(6-methoxy-1H-indazol-1-yl)propan-2-amine | Drug Info | [68] | |||
8 | (E)-2-(4-fluorostyryl)-5-(phenylsulfinyl)pyridine | Drug Info | [71] | |||
9 | (R,S)-1-(5-bromo-1H-indol-1-yl)propan-2-amine | Drug Info | [72] | |||
10 | (R,S)-1-(5-chloro-1H-indol-1-yl)propan-2-amine | Drug Info | [72] | |||
11 | (R,S)-1-(5-fluoro-1H-indol-1-yl)propan-2-amine | Drug Info | [72] | |||
12 | (R,S)-1-(5-methyl-1H-indol-1-yl)propan-2-amine | Drug Info | [72] | |||
13 | (R,S)-1-(6-fluoro-1H-indol-1-yl)propan-2-amine | Drug Info | [72] | |||
14 | (S)-1-(5,6-difluoro-1H-indol-1-yl)propan-2-amine | Drug Info | [72] | |||
15 | 1-((R)-2-aminopropyl)-1H-indazol-6-ol | Drug Info | [73] | |||
16 | 1-((S)-2-aminopropyl)-1H-indazol-6-ol | Drug Info | [73] | |||
17 | 1-((S)-2-aminopropyl)-7-chloro-1H-indazol-6-ol | Drug Info | [73] | |||
18 | 1-((S)-2-aminopropyl)-7-fluoro-1H-indazol-6-ol | Drug Info | [73] | |||
19 | 1-((S)-2-aminopropyl)-7-iodo-1H-indazol-6-ol | Drug Info | [73] | |||
20 | 1-((S)-2-aminopropyl)-7-methyl-1H-indazol-6-ol | Drug Info | [73] | |||
21 | 1-(2-aminoethyl)-1H-indazol-6-ol | Drug Info | [73] | |||
22 | 1-(2-Dimethylamino-ethyl)-1H-indol-4-ol | Drug Info | [74] | |||
23 | 1-(piperazin-1-yl)isoquinoline | Drug Info | [75] | |||
24 | 1-Butyl-3-(2-dimethylamino-ethyl)-1H-indol-4-ol | Drug Info | [74] | |||
25 | 2-(5-Methoxy-1H-indol-3-yl)-1-methyl-ethylamine | Drug Info | [73] | |||
26 | 2-(piperazin-1-yl)-5,6,7,8-tetrahydroquinoline | Drug Info | [75] | |||
27 | 3-(2-Amino-propyl)-1H-indol-5-ol | Drug Info | [73] | |||
28 | 3-(2-Dimethylamino-ethyl)-1-methyl-1H-indol-4-ol | Drug Info | [74] | |||
29 | 3-(2-Dimethylamino-ethyl)-1H-indol-6-ol | Drug Info | [74] | |||
30 | 3-(2-Dimethylamino-ethyl)-2-methyl-1H-indol-4-ol | Drug Info | [74] | |||
31 | 3-(2-Dimethylamino-propyl)-1H-indol-4-ol | Drug Info | [74] | |||
32 | 3-(2-Pyrrolidin-1-yl-ethyl)-1H-indol-4-ol | Drug Info | [74] | |||
33 | 3-(3-Dimethylamino-propyl)-1H-indol-4-ol | Drug Info | [74] | |||
34 | 3-Dimethylaminomethyl-1-methyl-1H-indol-4-ol | Drug Info | [74] | |||
35 | 3-Dimethylaminomethyl-1H-indol-4-ol | Drug Info | [74] | |||
36 | 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [76] | |||
37 | 4-(piperazin-1-yl)-7H-pyrrolo[2,3-d]pyrimidine | Drug Info | [75] | |||
38 | 4-(piperazin-1-yl)furo[3,2-c]pyridine | Drug Info | [75] | |||
39 | 4-(piperazin-1-yl)thieno[2,3-d]pyrimidine | Drug Info | [75] | |||
40 | 4-(piperazin-1-yl)thieno[3,2-c]pyridine | Drug Info | [75] | |||
41 | 4-(piperazin-1-yl)thieno[3,2-d]pyrimidine | Drug Info | [75] | |||
42 | 5,6-dichloro-3,4-dihydroquinazolin-2-amine | Drug Info | [77] | |||
43 | 5-chloro-3,4-dihydroquinazolin-2-amine | Drug Info | [77] | |||
44 | 5-chloro-4-ethyl-3,4-dihydroquinazolin-2-amine | Drug Info | [77] | |||
45 | 5-chloro-4-methyl-3,4-dihydroquinazolin-2-amine | Drug Info | [77] | |||
46 | 5-chloro-N-(pyridin-3-yl)indoline-1-carboxamide | Drug Info | [72] | |||
47 | 5-MEO-DMT | Drug Info | [73] | |||
48 | 6,7-dichloro-2,3,4,5-tetrahydro-1H-3-benzazepine | Drug Info | [79] | |||
49 | 6-(piperazin-1-yl)-9-propyl-9H-purine | Drug Info | [75] | |||
50 | 6-bromo-2'-de-N-methylaplysinopsin | Drug Info | [80] | |||
51 | 6-bromo-8-(piperazin-1-yl)imidazo[1,2-a]pyrazine | Drug Info | [75] | |||
52 | 6-bromoaplysinopsin | Drug Info | [80] | |||
53 | 6-chloro-N-(pyridin-3-yl)indoline-1-carboxamide | Drug Info | [72] | |||
54 | 6-methyl-4-(piperazin-1-yl)furo[2,3-d]pyrimidine | Drug Info | [75] | |||
55 | 7,8,9,10-tetrahydro-6H-furo-[2,3-g][3]benzazepine | Drug Info | [79] | |||
56 | 7,8,9,10-tetrahydro-6H-furo-[3,2-g][3]benzazepine | Drug Info | [79] | |||
57 | 8-methoxy-4-methyl-3,4-dihydroquinazolin-2-amine | Drug Info | [77] | |||
58 | Aplysinopsin | Drug Info | [72] | |||
59 | BARETTIN | Drug Info | [83] | |||
60 | CHLOROPHENYLPIPERAZINE | Drug Info | [87] | |||
61 | Cyclo[(6-bromotryptophan)arginine] | Drug Info | [83] | |||
62 | N-(6-phenoxypyridin-3-yl)-1H-indole-3-carboxamide | Drug Info | [98] | |||
63 | N-(pyridin-3-yl)indoline-1-carboxamide | Drug Info | [72] | |||
64 | N-3'-ethylaplysinopsin | Drug Info | [80] | |||
65 | OCTOCLOTHEPIN | Drug Info | [100] | |||
66 | PG-01037 | Drug Info | [101] | |||
67 | RS-102,221 | Drug Info | [102] | |||
68 | SB-271046 | Drug Info | [107] | |||
69 | SEROTONIN | Drug Info | [83] | |||
70 | VER-2692 | Drug Info | [108] | |||
71 | VER-3323 | Drug Info | [109] | |||
72 | VER-5384 | Drug Info | [109] | |||
73 | VER-5593 | Drug Info | [109] | |||
74 | WAY-208466 | Drug Info | [111] | |||
75 | WAY-466 | Drug Info | [112] | |||
76 | YM-348 | Drug Info | [79] | |||
77 | [2-(4-Fluoro-1H-indol-3-yl)-ethyl]-dimethyl-amine | Drug Info | [74] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 5 KEGG Pathways | + | ||||
1 | Calcium signaling pathway | |||||
2 | Neuroactive ligand-receptor interaction | |||||
3 | Gap junction | |||||
4 | Serotonergic synapse | |||||
5 | Inflammatory mediator regulation of TRP channels | |||||
Panther Pathway | [+] 1 Panther Pathways | + | ||||
1 | 5HT2 type receptor mediated signaling pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Serotonin receptors | |||||
2 | G alpha (q) signalling events | |||||
WikiPathways | [+] 6 WikiPathways | + | ||||
1 | Serotonin Receptor 2 and ELK-SRF/GATA4 signaling | |||||
2 | Monoamine GPCRs | |||||
3 | GPCRs, Class A Rhodopsin-like | |||||
4 | Gastrin-CREB signalling pathway via PKC and MAPK | |||||
5 | GPCR ligand binding | |||||
6 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Spinal serotonin receptor activation modulates the exercise ventilatory response with increased dead space in goats. Respir Physiol Neurobiol. 2008 May 31;161(3):230-8. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2941). | |||||
REF 3 | Nat Rev Drug Discov. 2013 Feb;12(2):87-90. | |||||
REF 4 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 134). | |||||
REF 6 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 012516. | |||||
REF 7 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7241). | |||||
REF 8 | Emerging treatments for depression. Expert Opin Pharmacother. 2006 Dec;7(17):2323-39. | |||||
REF 9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8286). | |||||
REF 10 | Local effect of tramadol on formalin evoked flinching behavior in rats. Rev Bras Anestesiol. 2008 Jul-Aug;58(4):375-9, 371-5. | |||||
REF 11 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 12 | ClinicalTrials.gov (NCT00495885) Efficacy and Safety of M100907 on Sleep Maintenance Insomnia With a Sub-study in Stable Type II Diabetes Mellitus. U.S. National Institutes of Health. | |||||
REF 13 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. | |||||
REF 14 | ClinicalTrials.gov (NCT00735683) A Short-Term Study to Examine the Effects of ATHX-105 Phosphate on Weight Loss and Safety. U.S. National Institutes of Health. | |||||
REF 15 | ClinicalTrials.gov (NCT02035553) A Study of the Safety and Efficacy of Pimavanserin in Patients With Alzheimer's Disease Psychosis. U.S. National Institutes of Health. | |||||
REF 16 | 2011 Pipeline of Proximagen Group plc. | |||||
REF 17 | ClinicalTrials.gov (NCT00854724) Puerarin Effects on Alcohol Drinking. U.S. National Institutes of Health. | |||||
REF 18 | ClinicalTrials.gov (NCT00768612) Study Evaluating Safety and Tolerability of Vabicaserin in Patients With Sudden Worsening of Schizophrenia. U.S. National Institutes of Health. | |||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023694) | |||||
REF 20 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5490). | |||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001479) | |||||
REF 22 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 97). | |||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000237) | |||||
REF 24 | Dopaminergic mechanisms of reinstatement of MDMA-seeking behaviour in rats. Br J Pharmacol. 2011 Apr;162(8):1770-80. | |||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017316) | |||||
REF 26 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016366) | |||||
REF 27 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 273). | |||||
REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000690) | |||||
REF 29 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 171). | |||||
REF 30 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009204) | |||||
REF 31 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 195). | |||||
REF 32 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006463) | |||||
REF 33 | Anti-obesity drugs. Expert Opin Pharmacother. 2008 Jun;9(8):1339-50. | |||||
REF 34 | Clinical pipeline report, company report or official report of Arena Pharmaceuticals (2011). | |||||
REF 35 | Pharmacological characterisation of the agonist radioligand binding site of 5-HT(2A), 5-HT(2B) and 5-HT(2C) receptors. Naunyn Schmiedebergs Arch Pharmacol. 2004 Aug;370(2):114-23. | |||||
REF 36 | Intake of fermented soybean (natto) increased locomotor activity in mice. Biol Pharm Bull. 2007 Apr;30(4):845-6. | |||||
REF 37 | Serotonergic mechanisms of the lateral parabrachial nucleus in renal and hormonal responses to isotonic blood volume expansion. Am J Physiol Regul Integr Comp Physiol. 2007 Mar;292(3):R1190-7. | |||||
REF 38 | p-Chloroamphetamine, a serotonin-releasing drug, elicited in rats a hyperglycemia mediated by the 5-HT1A and 5-HT2B/2C receptors. Eur J Pharmacol. 1998 Oct 23;359(2-3):185-90. | |||||
REF 39 | Inverse agonist and neutral antagonist actions of antidepressants at recombinant and native 5-hydroxytryptamine2C receptors: differential modulatio... Mol Pharmacol. 2008 Mar;73(3):748-57. | |||||
REF 40 | Serotonin 5-HT2C receptors as a target for the treatment of depressive and anxious states: focus on novel therapeutic strategies. Therapie. 2005 Sep-Oct;60(5):441-60. | |||||
REF 41 | Serotonin reuptake inhibitors: the corner stone in treatment of depression for half a century--a medicinal chemistry survey. Curr Top Med Chem. 2006;6(17):1801-23. | |||||
REF 42 | The inhibitory effects of tramadol on 5-hydroxytryptamine type 2C receptors expressed in Xenopus oocytes. Anesth Analg. 2004 May;98(5):1401-6, table of contents. | |||||
REF 43 | Clinical pipeline report, company report or official report of Jazz Pharmaceuticals. | |||||
REF 44 | Non-basic ligands for aminergic GPCRs: the discovery and development diaryl sulfones as selective, orally bioavailable 5-HT2A receptor antagonists ... Bioorg Med Chem Lett. 2010 Jun 15;20(12):3708-12. | |||||
REF 45 | SR46349-B, a 5-HT(2A/2C) receptor antagonist, potentiates haloperidol-induced dopamine release in rat medial prefrontal cortex and nucleus accumbens. Neuropsychopharmacology. 2002 Sep;27(3):430-41. | |||||
REF 46 | Pharmacological targeting of the serotonergic system for the treatment of obesity. J Physiol. 2009 January 1; 587(Pt 1): 49-60. | |||||
REF 47 | The neuropharmacology of sleep paralysis hallucinations: serotonin 2A activation and a novel therapeutic drug. Psychopharmacology (Berl). 2018 Nov;235(11):3083-3091. | |||||
REF 48 | NPI-031G (puerarin) reduces anxiogenic effects of alcohol withdrawal or benzodiazepine inverse or 5-HT2C agonists. Pharmacol Biochem Behav. 2003 Jun;75(3):619-25. | |||||
REF 49 | Prediction of Efficacy of Vabicaserin, a 5-HT2C Agonist, for the Treatment of Schizophrenia Using a Quantitative Systems Pharmacology Model.CPT Pharmacometrics Syst Pharmacol.2014 Apr 23;3:e111. | |||||
REF 50 | Characterization of vabicaserin (SCA-136), a selective 5-hydroxytryptamine 2C receptor agonist. J Pharmacol Exp Ther. 2011 Jun;337(3):673-80. | |||||
REF 51 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | |||||
REF 52 | Novel serotonin receptor 2 (5-HT2R) agonists and antagonists: a patent review (2004-2014).Expert Opin Ther Pat. 2016;26(1):89-106. | |||||
REF 53 | Deramciclane, a putative anxiolytic drug, is a serotonin 5-HT2C receptor inverse agonist but fails to induce 5-HT2C receptor down-regulation. Psychopharmacology (Berl). 1998 Mar;136(2):99-104. | |||||
REF 54 | Pharmacokinetics and safety of deramciclane during multiple oral dosing. Int J Clin Pharmacol Ther. 1999 Dec;37(12):589-97. | |||||
REF 55 | Deramciclane (Egis).Curr Opin Investig Drugs.2002 Feb;3(2):289-94. | |||||
REF 56 | Characterization of contractile 5-hydroxytryptamine receptor subtypes in the in situ autoperfused kidney in the anaesthetized rat. Eur J Pharmacol. 2008 Sep 11;592(1-3):133-7. | |||||
REF 57 | Hypersensitivity of 5-HT2 receptors in OCD patients. An increased prolactin response after a challenge with meta-chlorophenylpiperazine and pre-tre... J Psychiatr Res. 2008 Sep;42(11):894-901. | |||||
REF 58 | Effects of antipsychotics and reference monoaminergic ligands on marble burying behavior in mice. Behav Pharmacol. 2008 Mar;19(2):145-52. | |||||
REF 59 | Combined treatment of portal hypertension with ritanserin and propranolol in conscious and unrestrained cirrhotic rats. Hepatology. 1992 May;15(5):878-82. | |||||
REF 60 | mCPP-induced hyperactivity in 5-HT2C receptor mutant mice is mediated by activation of multiple 5-HT receptor subtypes. Neuropharmacology. 2004 Apr;46(5):663-71. | |||||
REF 61 | Antiaversive effects of 5HT2C receptor agonists and fluoxetine in a model of panic-like anxiety in rats. Eur Neuropsychopharmacol. 1998 Aug;8(3):161-8. | |||||
REF 62 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016366) | |||||
REF 63 | Serotonin 5-HT(2A) receptor antagonists in the treatment of insomnia: present status and future prospects.Drugs Today (Barc).2010 Mar;46(3):183-93. | |||||
REF 64 | The 5-hydroxytryptamine2A receptor is involved in (+)-norfenfluramine-induced arterial contraction and blood pressure increase in deoxycorticostero... J Pharmacol Exp Ther. 2007 May;321(2):485-91. | |||||
REF 65 | Some studies on the 5-hydroxytryptamine receptors in the isolated rat uterus. Afr J Med Med Sci. 2002 Dec;31(4):361-5. | |||||
REF 66 | The fenfluramine metabolite (+)-norfenfluramine is vasoactive. J Pharmacol Exp Ther. 2004 May;309(2):845-52. | |||||
REF 67 | Role of 5-hT2C receptors in the hypophagic effect of m-CPP, ORG 37684 and CP-94,253 in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2002 Apr;26(3):441-9. | |||||
REF 68 | Synthesis and structure-activity relationships of a series of substituted 2-(1H-furo[2,3-g]indazol-1-yl)ethylamine derivatives as 5-HT2C receptor a... Bioorg Med Chem. 2008 Feb 15;16(4):1966-82. | |||||
REF 69 | Effect of the activation of central 5-HT2C receptors by the 5-HT2C agonist mCPP on blood pressure and heart rate in rats. Brain Res. 2005 Apr 8;1040(1-2):64-72. | |||||
REF 70 | Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. | |||||
REF 71 | 2,5-Disubstituted pyridines: the discovery of a novel series of 5-HT2A ligands. Bioorg Med Chem Lett. 2007 May 1;17(9):2643-8. | |||||
REF 72 | Synthesis and structure-affinity relationships of novel small molecule natural product derivatives capable of discriminating between serotonin 5-HT1A, 5-HT2A, 5-HT2C receptor subtypes. Bioorg Med Chem. 2010 Jul 1;18(13):4783-92. | |||||
REF 73 | 1-((S)-2-aminopropyl)-1H-indazol-6-ol: a potent peripherally acting 5-HT2 receptor agonist with ocular hypotensive activity. J Med Chem. 2006 Jan 12;49(1):318-28. | |||||
REF 74 | SAR of psilocybin analogs: discovery of a selective 5-HT 2C agonist. Bioorg Med Chem Lett. 2005 Oct 15;15(20):4555-9. | |||||
REF 75 | Design and synthesis of orally-active and selective azaindane 5HT2c agonist for the treatment of obesity. Bioorg Med Chem Lett. 2010 Jan 1;20(1):266-71. | |||||
REF 76 | Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97. | |||||
REF 77 | Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61. | |||||
REF 78 | Agonist high and low affinity state ratios predict drug intrinsic activity and a revised ternary complex mechanism at serotonin 5-HT(2A) and 5-HT(2C) receptors. Synapse. 2000 Feb;35(2):144-50. | |||||
REF 79 | Synthesis and structure-activity relationships of a series of benzazepine derivatives as 5-HT2C receptor agonists. Bioorg Med Chem. 2008 Mar 15;16(6):3309-20. | |||||
REF 80 | New antiinfective and human 5-HT2 receptor binding natural and semisynthetic compounds from the Jamaican sponge Smenospongia aurea. J Nat Prod. 2002 Apr;65(4):476-80. | |||||
REF 81 | A novel and selective 5-HT2 receptor agonist with ocular hypotensive activity: (S)-(+)-1-(2-aminopropyl)-8,9-dihydropyrano[3,2-e]indole. J Med Chem. 2003 Sep 11;46(19):4188-95. | |||||
REF 82 | High-affinity agonist binding correlates with efficacy (intrinsic activity) at the human serotonin 5-HT2A and 5-HT2C receptors: evidence favoring the ternary complex and two-state models of agonist action. J Neurochem. 1999 May;72(5):2127-34. | |||||
REF 83 | Brominated cyclodipeptides from the marine sponge Geodia barretti as selective 5-HT ligands. J Nat Prod. 2006 Oct;69(10):1421-4. | |||||
REF 84 | SB-216641 and BRL-15572--compounds to pharmacologically discriminate h5-HT1B and h5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1997 Sep;356(3):312-20. | |||||
REF 85 | Obesity: pathophysiology and clinical management. Curr Med Chem. 2009;16(4):506-21. | |||||
REF 86 | Agonist actions of dihydroergotamine at 5-HT2B and 5-HT2C receptors and their possible relevance to antimigraine efficacy. Br J Pharmacol. 2003 Sep;140(2):277-84. | |||||
REF 87 | Tricyclic dihydroquinazolinones as novel 5-HT2C selective and orally efficacious anti-obesity agents. Bioorg Med Chem Lett. 2010 Feb 1;20(3):1128-33. | |||||
REF 88 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 8). | |||||
REF 89 | Affinity of cyamemazine, an anxiolytic antipsychotic drug, for human recombinant dopamine vs. serotonin receptor subtypes. Biochem Pharmacol. 2003 Feb 1;65(3):435-40. | |||||
REF 90 | Effects of EGIS-7625, a selective and competitive 5-HT2B receptor antagonist. Cardiovasc Drugs Ther. 2003 Sep-Nov;17(5-6):427-34. | |||||
REF 91 | Anxiolytic activity of a novel potent serotonin 5-HT2C receptor antagonist FR260010: a comparison with diazepam and buspirone. Eur J Pharmacol. 2006 Dec 28;553(1-3):171-84. | |||||
REF 92 | A novel class of 5-HT2A receptor antagonists: aryl aminoguanidines. Life Sci. 1996;59(15):1259-68. | |||||
REF 93 | Pharmacological profile of YM348, a novel, potent and orally active 5-HT2C receptor agonist. Eur J Pharmacol. 2004 Jan 1;483(1):37-43. | |||||
REF 94 | The origin of MDMA (ecstasy) revisited: the true story reconstructed from the original documents. Addiction. 2006 Sep;101(9):1241-5. | |||||
REF 95 | [Agonists of 5HT2C-receptors SCH 23390 and MK 212 incresase the force of rat aorta contraction in the presence of vasopressin and angiotensin II].Patol Fiziol Eksp Ter.2014 Oct-Dec;(4):17-29. | |||||
REF 96 | Effects of 5-hydroxytryptamine 2C receptor agonist MK212 and 2A receptor antagonist MDL100907 on maternal behavior in postpartum female rats.Pharmacol Biochem Behav.2014 Feb;117:25-33. | |||||
REF 97 | 2-Substituted tryptamines: agents with selectivity for 5-HT(6) serotonin receptors. J Med Chem. 2000 Mar 9;43(5):1011-8. | |||||
REF 98 | Synthesis and structure-activity relationship of 1H-indole-3-carboxylic acid pyridine-3-ylamides: a novel series of 5-HT2C receptor antagonists. Bioorg Med Chem Lett. 2008 Jul 15;18(14):3844-7. | |||||
REF 99 | Evidence for possible involvement of 5-HT(2B) receptors in the cardiac valvulopathy associated with fenfluramine and other serotonergic medications. Circulation. 2000 Dec 5;102(23):2836-41. | |||||
REF 100 | Exploring the neuroleptic substituent in octoclothepin: potential ligands for positron emission tomography with subnanomolar affinity for (1)-adre... J Med Chem. 2010 Oct 14;53(19):7021-34. | |||||
REF 101 | Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3... J Med Chem. 2007 Aug 23;50(17):4135-46. | |||||
REF 102 | cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain... J Med Chem. 2008 Nov 27;51(22):7094-8. | |||||
REF 103 | Attenuation of haloperidol-induced catalepsy by a 5-HT2C receptor antagonist. Br J Pharmacol. 1999 Feb;126(3):572-4. | |||||
REF 104 | Biarylcarbamoylindolines are novel and selective 5-HT(2C) receptor inverse agonists: identification of 5-methyl-1-[[2-[(2-methyl-3-pyridyl)oxy]- 5-pyridyl]carbamoyl]-6-trifluoromethylindoline (SB-243213) as a potential antidepressant/anxiolytic agent. J Med Chem. 2000 Mar 23;43(6):1123-34. | |||||
REF 105 | SB 242084, a selective and brain penetrant 5-HT2C receptor antagonist. Neuropharmacology. 1997 Apr-May;36(4-5):609-20. | |||||
REF 106 | SB-243213; a selective 5-HT2C receptor inverse agonist with improved anxiolytic profile: lack of tolerance and withdrawal anxiety. Neuropharmacology. 2001 Aug;41(2):186-99. | |||||
REF 107 | Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. | |||||
REF 108 | Pyrrolo(iso)quinoline derivatives as 5-HT(2C) receptor agonists. Bioorg Med Chem Lett. 2006 Feb;16(3):677-80. | |||||
REF 109 | Indoline derivatives as 5-HT(2C) receptor agonists. Bioorg Med Chem Lett. 2004 May 3;14(9):2367-70. | |||||
REF 110 | WAY-163909 [(7bR, 10aR)-1,2,3,4,8,9,10,10a-octahydro-7bH-cyclopenta-[b][1,4]diazepino[6,7,1hi]indole], a novel 5-hydroxytryptamine 2C receptor-sele... J Pharmacol Exp Ther. 2005 May;313(2):862-9. | |||||
REF 111 | Novel 1-aminoethyl-3-arylsulfonyl-1H-pyrrolo[2,3-b]pyridines are potent 5-HT(6) agonists. Bioorg Med Chem. 2009 Jul 15;17(14):5153-63. | |||||
REF 112 | Discovery of 5-arylsulfonamido-3-(pyrrolidin-2-ylmethyl)-1H-indole derivatives as potent, selective 5-HT6 receptor agonists and antagonists. J Med Chem. 2005 Jan 27;48(2):353-6. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.