Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T16691
(Former ID: TTDC00185)
|
|||||
Target Name |
5-HT 6 receptor (HTR6)
|
|||||
Synonyms |
Serotonin receptor 6; 5-hydroxytryptamine receptor 6; 5-HT6 receptor; 5-HT6; 5-HT-6
Click to Show/Hide
|
|||||
Gene Name |
HTR6
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Alzheimer disease [ICD-11: 8A20] | |||||
2 | Schizophrenia [ICD-11: 6A20] | |||||
Function |
The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase. It has a high affinity for tricyclic psychotropic drugs. Controls pyramidal neurons migration during corticogenesis, through the regulation of CDK5 activity. Is an activator of TOR signaling. This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF FNIDPAEPELRPHPLGIPTN Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 15 Clinical Trial Drugs | + | ||||
1 | LU AE58054 | Drug Info | Phase 3 | Schizophrenia | [2], [3] | |
2 | SB-742457 | Drug Info | Phase 3 | Alzheimer disease | [4] | |
3 | AVN 211 | Drug Info | Phase 2/3 | Schizophrenia | [5] | |
4 | AVN 101 | Drug Info | Phase 2 | Anxiety disorder | [6] | |
5 | AVN 322 | Drug Info | Phase 2 | Cognitive impairment | [7] | |
6 | PF-05212377 | Drug Info | Phase 2 | Alzheimer disease | [8] | |
7 | SAM-531 | Drug Info | Phase 2 | Alzheimer disease | [9], [10] | |
8 | SUVN-502 | Drug Info | Phase 2 | Neurological disorder | [11] | |
9 | SYN-120 | Drug Info | Phase 2 | Alzheimer disease | [12] | |
10 | SYN120 | Drug Info | Phase 2 | Parkinson disease | [13] | |
11 | 11C-GSK-215083 | Drug Info | Phase 1 | Neurodegenerative disorder | [14], [15] | |
12 | ABT-354 | Drug Info | Phase 1 | Alzheimer disease | [16] | |
13 | AVN-322 | Drug Info | Phase 1 | Alzheimer disease | [17] | |
14 | BVT-74316 | Drug Info | Phase 1 | Obesity | [18] | |
15 | PRX-07034 | Drug Info | Phase 1 | Obesity | [19] | |
Patented Agent(s) | [+] 2 Patented Agents | + | ||||
1 | PMID30124346-Compound-13TABLE4 | Drug Info | Patented | Attention deficit hyperactivity disorder | [20] | |
2 | PMID30124346-Compound-34TABLE4 | Drug Info | Patented | Attention deficit hyperactivity disorder | [20] | |
Discontinued Drug(s) | [+] 3 Discontinued Drugs | + | ||||
1 | AVN 397 | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [21] | |
2 | SYN-114 | Drug Info | Discontinued in Phase 1 | Cognitive impairment | [22] | |
3 | WAY-181187 | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [23], [24] | |
Mode of Action | [+] 6 Modes of Action | + | ||||
Enhancer | [+] 1 Enhancer drugs | + | ||||
1 | LU AE58054 | Drug Info | [25] | |||
Antagonist | [+] 24 Antagonist drugs | + | ||||
1 | SB-742457 | Drug Info | [26], [27] | |||
2 | PF-05212377 | Drug Info | [29] | |||
3 | SAM-531 | Drug Info | [30] | |||
4 | SUVN-502 | Drug Info | [31] | |||
5 | SYN-120 | Drug Info | [32] | |||
6 | SYN120 | Drug Info | [33] | |||
7 | 11C-GSK-215083 | Drug Info | [34] | |||
8 | AVN-322 | Drug Info | [36] | |||
9 | BVT-74316 | Drug Info | [37] | |||
10 | PRX-07034 | Drug Info | [38] | |||
11 | AVN 397 | Drug Info | [28] | |||
12 | SYN-114 | Drug Info | [39] | |||
13 | 2-bromo-LSD | Drug Info | [48] | |||
14 | alpha-ergocryptine | Drug Info | [68] | |||
15 | bufotenine | Drug Info | [57] | |||
16 | fluperlapine | Drug Info | [75] | |||
17 | MPDT | Drug Info | [74] | |||
18 | SB 258585 | Drug Info | [77] | |||
19 | SB399885 | Drug Info | [80] | |||
20 | SUVN-501 | Drug Info | [69] | |||
21 | SUVN-504 | Drug Info | [69] | |||
22 | SUVN-507 | Drug Info | [69] | |||
23 | [125I]SB-258585 | Drug Info | [77] | |||
24 | [3H]Ro 63-0563 | Drug Info | [1], [79] | |||
Modulator | [+] 8 Modulator drugs | + | ||||
1 | AVN 211 | Drug Info | [28] | |||
2 | AVN 101 | Drug Info | [28] | |||
3 | AVN 322 | Drug Info | [26] | |||
4 | ABT-354 | Drug Info | [35] | |||
5 | WAY-181187 | Drug Info | [40] | |||
6 | AMR-SIX-1 | Drug Info | [69] | |||
7 | SB-214111 | Drug Info | [78] | |||
8 | SEL-73 | Drug Info | [69] | |||
Ligand | [+] 2 Ligand drugs | + | ||||
1 | PMID30124346-Compound-13TABLE4 | Drug Info | [20] | |||
2 | PMID30124346-Compound-34TABLE4 | Drug Info | [20] | |||
Inhibitor | [+] 75 Inhibitor drugs | + | ||||
1 | (+/-)-nantenine | Drug Info | [41] | |||
2 | 1-(2-Methoxy-phenyl)-piperazine | Drug Info | [42] | |||
3 | 1-(3-(benzyloxy)-2-methylphenyl)piperazine | Drug Info | [43] | |||
4 | 1-(3-(pentafluorosulfanyl)phenyl)propan-2-amine | Drug Info | [44] | |||
5 | 1-(phenylsulfonyl)-4-(piperazin-1-yl)-1H-indole | Drug Info | [45] | |||
6 | 1-Benzenesulfonyl-3-piperidin-3-yl-1H-indole | Drug Info | [46] | |||
7 | 1-Benzenesulfonyl-3-piperidin-4-yl-1H-indole | Drug Info | [47] | |||
8 | 1-phenylthio-N,N-dimethyltryptamine | Drug Info | [49] | |||
9 | 2-(1-(phenylsulfonyl)-1H-indol-3-yl)ethanamine | Drug Info | [50] | |||
10 | 2-(1-benzyl-1H-inden-3-yl)-N,N-dimethylethanamine | Drug Info | [51] | |||
11 | 2-(1-benzyl-1H-indol-3-yl)-N,N-dimethylethanamine | Drug Info | [51] | |||
12 | 2-(1-tosyl-1H-indol-3-yl)ethanamine | Drug Info | [50] | |||
13 | 2-(1H-indol-3-yl)-N,N-dimethylethanamine | Drug Info | [52] | |||
14 | 2-(3-(phenylsulfonyl)-1H-indol-1-yl)ethanamine | Drug Info | [53] | |||
15 | 2-(3-benzenesulfonyl)phenyl-1-aminoethane | Drug Info | [54] | |||
16 | 2-(3-phenylthio)phenyl)-1-aminoethane | Drug Info | [54] | |||
17 | 2-(4-(benzenesulfonyl)phenyl)-1-aminoethane | Drug Info | [54] | |||
18 | 2-Benzyl-4-piperazin-1-yl-1H-benzimidazole | Drug Info | [55] | |||
19 | 2-Ethyl-5-methoxy-3-piperidin-4-yl-1H-indole | Drug Info | [56] | |||
20 | 3-(phenylsulfonyl)-1-(piperidin-3-yl)-1H-indole | Drug Info | [58] | |||
21 | 3-(phenylsulfonyl)-1-(piperidin-4-yl)-1H-indole | Drug Info | [58] | |||
22 | 3-(phenylsulfonyl)-1-(pyrrolidin-3-yl)-1H-indole | Drug Info | [58] | |||
23 | 4-((1H-indol-1-yl)methyl)benzenamine | Drug Info | [59] | |||
24 | 4-(1H-Inden-1-ylmethyl)-phenylamine | Drug Info | [60] | |||
25 | 4-(1H-indol-1-ylsulfonyl)benzenamine | Drug Info | [45] | |||
26 | 4-(1H-Indol-3-ylmethyl)-phenylamine | Drug Info | [60] | |||
27 | 4-(2-benzenesulfonylphenyl)piperazine | Drug Info | [54] | |||
28 | 4-(3-benzenesulfonamidophenyl)piperazine | Drug Info | [54] | |||
29 | 4-(3-benzenesulfonylphenyl)piperazine | Drug Info | [54] | |||
30 | 4-(3-Methyl-indole-1-sulfonyl)-phenylamine | Drug Info | [42] | |||
31 | 4-(3H-Inden-1-ylmethyl)-phenylamine | Drug Info | [60] | |||
32 | 4-(4,6-dinitro-1H-indol-1-ylsulfonyl)benzenamine | Drug Info | [45] | |||
33 | 4-(4-benzenesulfonamidophenyl)piperazine | Drug Info | [54] | |||
34 | 4-(4-benzenesulfonylphenyl)piperazine | Drug Info | [54] | |||
35 | 4-(4-methoxy-1H-indol-1-ylsulfonyl)benzenamine | Drug Info | [61] | |||
36 | 4-(6-methoxy-1H-indol-1-ylsulfonyl)benzenamine | Drug Info | [61] | |||
37 | 4-(Indan-1-ylsulfanyl)-phenylamine | Drug Info | [60] | |||
38 | 4-(Indane-1-sulfonyl)-phenylamine | Drug Info | [60] | |||
39 | 4-(Naphthalene-1-sulfonyl)-phenylamine | Drug Info | [42] | |||
40 | 4-(piperazin-1-yl)-1H-indole | Drug Info | [45] | |||
41 | 4-(piperazin-1-yl)-3-tosyl-1H-indazole | Drug Info | [62] | |||
42 | 4-Indan-1-ylmethyl-phenylamine | Drug Info | [60] | |||
43 | 4-Inden-(1E)-ylidenemethyl-phenylamine | Drug Info | [60] | |||
44 | 5,6-dichloro-3,4-dihydroquinazolin-2-amine | Drug Info | [63] | |||
45 | 5-(4-Methylpiperazin-1-yl)-3-tosyl-1H-indazole | Drug Info | [62] | |||
46 | 5-MEO-DMT | Drug Info | [65] | |||
47 | 5-METHOXYTRYPTAMINE | Drug Info | [66] | |||
48 | 6-(piperazin-1-yl)-3-tosyl-1H-indazole | Drug Info | [62] | |||
49 | 6-tosyl-1,2,3,4,5,6-hexahydroazepino[4,5-b]indole | Drug Info | [67] | |||
50 | CHLOROPHENYLPIPERAZINE | Drug Info | [71] | |||
51 | DIMEBOLIN | Drug Info | [72] | |||
52 | E-6837 | Drug Info | [51] | |||
53 | EDMT | Drug Info | [51], [74] | |||
54 | METHIOTHEPIN | Drug Info | [76] | |||
55 | N,N-diethyl-2-(1H-indol-3-yl)ethanamine | Drug Info | [65] | |||
56 | N,N-dimethyl-2-(1-tosyl-1H-indol-3-yl)ethanamine | Drug Info | [59] | |||
57 | N-(3-(2-aminoethyl)phenyl)benzenesulfonamide | Drug Info | [54] | |||
58 | N-(3-(3-aminopropyl)phenyl)benzenesulfonamide | Drug Info | [54] | |||
59 | N-(3-(aminomethyl)phenyl)benzenesulfonamide | Drug Info | [54] | |||
60 | N-(3-aminophenyl)benzenesulfonamide | Drug Info | [54] | |||
61 | N-(4-(2-aminoethyl)phenyl)benzenesulfonamide | Drug Info | [54] | |||
62 | N-phenyl-3-(2-aminoethyl)benzenesulfonamide | Drug Info | [54] | |||
63 | OCTOCLOTHEPIN | Drug Info | [66] | |||
64 | QUIPAZINE | Drug Info | [71] | |||
65 | Ro-04-6790 | Drug Info | [51] | |||
66 | SB-271046 | Drug Info | [43] | |||
67 | SB-357134 | Drug Info | [79] | |||
68 | SEROTONIN | Drug Info | [76] | |||
69 | WAY-208466 | Drug Info | [53] | |||
70 | WAY-466 | Drug Info | [81] | |||
71 | [2-(3-Benzyl-3H-inden-1-yl)-ethyl]-methyl-amine | Drug Info | [60] | |||
72 | [2-(3-Benzyl-3H-indol-1-yl)-ethyl]-dimethyl-amine | Drug Info | [82] | |||
73 | [2-(3-Benzyl-indol-1-yl)-ethyl]-dimethyl-amine | Drug Info | [60] | |||
74 | [2-(3H-Indol-1-yl)-ethyl]-dimethyl-amine | Drug Info | [82] | |||
75 | [3H]spiperone | Drug Info | [71] | |||
Agonist | [+] 15 Agonist drugs | + | ||||
1 | 1-naphthylpiperazine | Drug Info | [42], [48] | |||
2 | 2-methyl-5-HT | Drug Info | [57] | |||
3 | 5-CT | Drug Info | [64] | |||
4 | alpha-methyl-5-HT | Drug Info | [68] | |||
5 | BRL-15572 | Drug Info | [70] | |||
6 | DM-1451 | Drug Info | [73] | |||
7 | E6801 | Drug Info | [66] | |||
8 | EMD-386088 | Drug Info | [56] | |||
9 | lergotrile | Drug Info | [48] | |||
10 | LY 165,163 | Drug Info | [48] | |||
11 | m-chlorophenylpiperazine | Drug Info | [48] | |||
12 | OPC 4392 | Drug Info | [73] | |||
13 | TFMPP | Drug Info | [48] | |||
14 | [3H]5-CT | Drug Info | [69] | |||
15 | [3H]LSD | Drug Info | [73] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Human Similarity Proteins
Human Pathway Affiliation
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
Calcium signaling pathway | hsa04020 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
cAMP signaling pathway | hsa04024 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
|
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy | ||
Serotonergic synapse | hsa04726 | Affiliated Target |
|
Class: Organismal Systems => Nervous system | Pathway Hierarchy |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 4 KEGG Pathways | + | ||||
1 | Calcium signaling pathway | |||||
2 | cAMP signaling pathway | |||||
3 | Neuroactive ligand-receptor interaction | |||||
4 | Serotonergic synapse | |||||
Panther Pathway | [+] 1 Panther Pathways | + | ||||
1 | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
1 | Excitatory Neural Signalling Through 5-HTR 6 and Serotonin | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Serotonin receptors | |||||
2 | G alpha (s) signalling events | |||||
WikiPathways | [+] 5 WikiPathways | + | ||||
1 | Serotonin Receptor 4/6/7 and NR3C Signaling | |||||
2 | Monoamine GPCRs | |||||
3 | GPCRs, Class A Rhodopsin-like | |||||
4 | GPCR ligand binding | |||||
5 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation | ||||||
Target QSAR Model |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | The 5-hydroxytryptamine6 receptor-selective radioligand [3H]Ro 63-0563 labels 5-hydroxytryptamine receptor binding sites in rat and porcine striatum. Mol Pharmacol. 1998 Sep;54(3):577-83. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8689). | |||||
REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019915) | |||||
REF 4 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 5 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 6 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030006) | |||||
REF 7 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 8 | ClinicalTrials.gov (NCT01712074) Study Evaluating TheSafety And Efficacy Of PF-05212377 Or Placebo In Subjects With Alzheimer's Disease With Existing Neuropsychiatric Symptoms On Donepezil. U.S. National Institutes of Health. | |||||
REF 9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7356). | |||||
REF 10 | ClinicalTrials.gov (NCT00895895) Study Comparing 3 Dosage Levels Of SAM-531 In Outpatients With Mild To Moderate Alzheimer Disease. U.S. National Institutes of Health. | |||||
REF 11 | Clinical pipeline report, company report or official report of Suven Life Sciences. | |||||
REF 12 | ClinicalTrials.gov (NCT02258152) SYN120 a Dual 5-HT6/5-HT2A Antagonist Proof of Concept Study to Evaluate Its Safety, Tolerability and Efficacy in Parkinson's Disease Dementia (SYNAPSE). U.S. National Institutes of Health. | |||||
REF 13 | ClinicalTrials.gov (NCT02258152) SYN120 Study to Evaluate Its Safety, Tolerability and Efficacy in Parkinson's Disease Dementia (SYNAPSE) (SYNAPSE). U.S. National Institutes of Health. | |||||
REF 14 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8430). | |||||
REF 15 | List of drugs in development for neurodegenerative diseases: update October 2011. Neurodegener Dis. 2012;9(4):210-83. | |||||
REF 16 | ClinicalTrials.gov (NCT01908010) Safety, Tolerability, and Pharmacokinetics of ABT-354 in Subjects With Mild-to-Moderate Alzheimer's Disease on Stable Doses of Acetylcholinesterase Inhibitors. U.S. National Institutes of Health. | |||||
REF 17 | 5HT6 Antagonists in the Treatment of Alzheimer's Dementia: Current Progress. Neurol Ther. 2018 Jun;7(1):51-58. | |||||
REF 18 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023034) | |||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021329) | |||||
REF 20 | 5-HT1A receptor ligands and their therapeutic applications: review of new patents.Expert Opin Ther Pat. 2018 Sep;28(9):679-689. | |||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031584) | |||||
REF 22 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025583) | |||||
REF 23 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3240). | |||||
REF 24 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021227) | |||||
REF 25 | Lu AE58054, a 5-HT6 antagonist, reverses cognitive impairment induced by subchronic phencyclidine in a novel object recognition test in rats. Int J Neuropsychopharmacol. 2010 Sep;13(8):1021-33. | |||||
REF 26 | 5-HT6 receptors and Alzheimer's disease. Alzheimers Res Ther. 2013; 5(2): 15. | |||||
REF 27 | Clinical pipeline report, company report or official report of GlaxoSmithKline (2009). | |||||
REF 28 | Latrepirdine, a potential novel treatment for Alzheimer's disease and Huntington's chorea. Curr Opin Investig Drugs. 2010 January; 11(1): 80-91. | |||||
REF 29 | PF-05212377 Alzheimer's Disease (Phase 2). Pfizer. | |||||
REF 30 | Activation of 5-HT6 receptors modulates sleep-wake activity and hippocampal theta oscillation. ACS Chem Neurosci. 2013 Jan 16;4(1):191-9. | |||||
REF 31 | Novel and Potent 5-Piperazinyl Methyl-N1-aryl Sulfonyl Indole Derivatives as 5-HT6 Receptor Ligands. ACS Med Chem Lett. 2010 October 14; 1(7): 340-344. | |||||
REF 32 | The Serotonin-6 Receptor as a Novel Therapeutic Target. Exp Neurobiol. 2011 December; 20(4): 159-168. | |||||
REF 33 | Therapeutic strategies for Parkinson disease: beyond dopaminergic drugs. Nat Rev Drug Discov. 2018 Nov;17(11):804-822. | |||||
REF 34 | Radiosynthesis and characterization of 11C-GSK215083 as a PET radioligand for the 5-HT6 receptor. J Nucl Med. 2012 Feb;53(2):295-303. | |||||
REF 35 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035134) | |||||
REF 36 | AVN-322 is a Safe Orally Bio-Available Potent and Highly Selective Antagonist of 5-HT6R with Demonstrated Ability to Improve Impaired Memory in Animal Models. Curr Alzheimer Res. 2017;14(3):268-294. | |||||
REF 37 | Pharmacological targeting of the serotonergic system for the treatment of obesity. J Physiol. 2009 January 1; 587(Pt 1): 49-60. | |||||
REF 38 | Low-dose prazosin in combination with 5-HT6 antagonist PRX-07034 has antipsychotic effects. Can J Physiol Pharmacol. 2015 Jan;93(1):13-21. | |||||
REF 39 | Lewy bodies. Proc Natl Acad Sci U S A. 2006 February 7; 103(6): 1661-1668. | |||||
REF 40 | Neuropharmacological profile of novel and selective 5-HT6 receptor agonists: WAY-181187 and WAY-208466.Neuropsychopharmacology.2008 May;33(6):1323-35. | |||||
REF 41 | Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. | |||||
REF 42 | 1-(1-Naphthyl)piperazine as a novel template for 5-HT6 serotonin receptor ligands. Bioorg Med Chem Lett. 2005 Mar 15;15(6):1707-11. | |||||
REF 43 | Synthesis and SAR of tolylamine 5-HT6 antagonists. Bioorg Med Chem Lett. 2009 May 1;19(9):2409-12. | |||||
REF 44 | The synthesis and biological activity of pentafluorosulfanyl analogs of fluoxetine, fenfluramine, and norfenfluramine. Bioorg Med Chem. 2007 Nov 1;15(21):6659-66. | |||||
REF 45 | Binding of amine-substituted N1-benzenesulfonylindoles at human 5-HT6 serotonin receptors. Bioorg Med Chem Lett. 2005 Dec 1;15(23):5298-302. | |||||
REF 46 | Conformationally constrained N1-arylsulfonyltryptamine derivatives as 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2005 Nov 1;15(21):4780-5. | |||||
REF 47 | N1-arylsulfonyl-3-(1,2,3,6-tetrahydropyridin-4-yl)-1H-indole derivatives are potent and selective 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2005 Jan 17;15(2):379-83. | |||||
REF 48 | Cloning and expression of a novel serotonin receptor with high affinity for tricyclic psychotropic drugs. Mol Pharmacol. 1993 Mar;43(3):320-7. | |||||
REF 49 | Binding of serotonin and N1-benzenesulfonyltryptamine-related analogs at human 5-HT6 serotonin receptors: receptor modeling studies. J Med Chem. 2008 Feb 14;51(3):603-11. | |||||
REF 50 | Discovery of N1-(6-chloroimidazo[2,1-b][1,3]thiazole-5-sulfonyl)tryptamine as a potent, selective, and orally active 5-HT(6) receptor agonist. J Med Chem. 2007 Nov 15;50(23):5535-8. | |||||
REF 51 | Indene-based scaffolds. 2. An indole-indene switch: discovery of novel indenylsulfonamides as 5-HT6 serotonin receptor agonists. J Med Chem. 2009 Feb 12;52(3):675-87. | |||||
REF 52 | Dose-response study of N,N-dimethyltryptamine in humans. I. Neuroendocrine, autonomic, and cardiovascular effects. Arch Gen Psychiatry. 1994 Feb;51(2):85-97. | |||||
REF 53 | Novel 1-aminoethyl-3-arylsulfonyl-1H-pyrrolo[2,3-b]pyridines are potent 5-HT(6) agonists. Bioorg Med Chem. 2009 Jul 15;17(14):5153-63. | |||||
REF 54 | Binding of sulfonyl-containing arylalkylamines at human 5-HT6 serotonin receptors. J Med Chem. 2006 Aug 24;49(17):5217-25. | |||||
REF 55 | Benzimidazole derivatives as new serotonin 5-HT6 receptor antagonists. Molecular mechanisms of receptor inactivation. J Med Chem. 2010 Feb 11;53(3):1357-69. | |||||
REF 56 | 2-Alkyl-3-(1,2,3,6-tetrahydropyridin-4-yl)-1H-indoles as novel 5-HT6 receptor agonists. Bioorg Med Chem Lett. 2005 Oct 1;15(19):4230-4. | |||||
REF 57 | Functional and radioligand binding characterization of rat 5-HT6 receptors stably expressed in HEK293 cells. Neuropharmacology. 1997 Apr-May;36(4-5):713-20. | |||||
REF 58 | 3-(Arylsulfonyl)-1-(azacyclyl)-1H-indoles are 5-HT(6) receptor modulators. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1657-60. | |||||
REF 59 | Further studies on the binding of N1-substituted tryptamines at h5-HT6 receptors. Bioorg Med Chem Lett. 2007 Mar 15;17(6):1691-4. | |||||
REF 60 | Binding of isotryptamines and indenes at h5-HT6 serotonin receptors. Bioorg Med Chem Lett. 2005 Apr 15;15(8):1987-91. | |||||
REF 61 | Binding of methoxy-substituted N1-benzenesulfonylindole analogs at human 5-HT6 serotonin receptors. Bioorg Med Chem Lett. 2006 Jul 15;16(14):3793-6. | |||||
REF 62 | 5-Piperazinyl-3-sulfonylindazoles as potent and selective 5-hydroxytryptamine-6 antagonists. J Med Chem. 2010 Nov 11;53(21):7639-46. | |||||
REF 63 | Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61. | |||||
REF 64 | Cloning, characterization, and chromosomal localization of a human 5-HT6 serotonin receptor. J Neurochem. 1996 Jan;66(1):47-56. | |||||
REF 65 | Interaction of N1-unsubstituted and N1-benzenesulfonyltryptamines at h5-HT6 receptors. Bioorg Med Chem Lett. 2006 Nov 15;16(22):5832-5. | |||||
REF 66 | Medicinal chemistry driven approaches toward novel and selective serotonin 5-HT6 receptor ligands. J Med Chem. 2005 Mar 24;48(6):1781-95. | |||||
REF 67 | A regiospecific synthesis of a series of 1-sulfonyl azepinoindoles as potent 5-HT6 ligands. Bioorg Med Chem Lett. 2008 Jul 15;18(14):3929-31. | |||||
REF 68 | Identification of residues in transmembrane regions III and VI that contribute to the ligand binding site of the serotonin 5-HT6 receptor. J Neurochem. 1998 Nov;71(5):2169-77. | |||||
REF 69 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 11). | |||||
REF 70 | SB-216641 and BRL-15572--compounds to pharmacologically discriminate h5-HT1B and h5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1997 Sep;356(3):312-20. | |||||
REF 71 | Higher-end serotonin receptors: 5-HT(5), 5-HT(6), and 5-HT(7). J Med Chem. 2003 Jul 3;46(14):2795-812. | |||||
REF 72 | 8-Sulfonyl-substituted tetrahydro-1H-pyrido[4,3-b]indoles as 5-HT6 receptor antagonists. Eur J Med Chem. 2010 Feb;45(2):782-9. | |||||
REF 73 | Interactions of the novel antipsychotic aripiprazole (OPC-14597) with dopamine and serotonin receptor subtypes. Neuropsychopharmacology. 1999 Jun;20(6):612-27. | |||||
REF 74 | 2-Substituted tryptamines: agents with selectivity for 5-HT(6) serotonin receptors. J Med Chem. 2000 Mar 9;43(5):1011-8. | |||||
REF 75 | Binding of typical and atypical antipsychotic agents to 5-hydroxytryptamine-6 and 5-hydroxytryptamine-7 receptors. J Pharmacol Exp Ther. 1994 Mar;268(3):1403-10. | |||||
REF 76 | 5-Cyclic amine-3-arylsulfonylindazoles as novel 5-HT6 receptor antagonists. J Med Chem. 2010 Mar 25;53(6):2521-7. | |||||
REF 77 | 5-HT6 receptor binding sites in schizophrenia and following antipsychotic drug administration: autoradiographic studies with [125I]SB-258585. Synapse. 2002 Sep 1;45(3):191-9. | |||||
REF 78 | The distribution of 5-HT(6) receptors in rat brain: an autoradiographic binding study using the radiolabelled 5-HT(6) receptor antagonist [(125)I]S... Brain Res. 2002 Apr 26;934(1):49-57. | |||||
REF 79 | Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. | |||||
REF 80 | SB-399885 is a potent, selective 5-HT6 receptor antagonist with cognitive enhancing properties in aged rat water maze and novel object recognition ... Eur J Pharmacol. 2006 Dec 28;553(1-3):109-19. | |||||
REF 81 | Discovery of 5-arylsulfonamido-3-(pyrrolidin-2-ylmethyl)-1H-indole derivatives as potent, selective 5-HT6 receptor agonists and antagonists. J Med Chem. 2005 Jan 27;48(2):353-6. | |||||
REF 82 | Possible differences in modes of agonist and antagonist binding at human 5-HT6 receptors. Bioorg Med Chem Lett. 2004 Sep 6;14(17):4569-73. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.