Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T84621
(Former ID: TTDS00420)
|
|||||
| Target Name |
Steroid 11-beta-hydroxylase (CYP11B1)
|
|||||
| Synonyms |
S11BH; P450C11; P-450c11; CYPXIB1; CYP11B1
|
|||||
| Gene Name |
CYP11B1
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Breast cancer [ICD-11: 2C60-2C6Y] | |||||
| 2 | Cushing syndrome [ICD-11: 5A70] | |||||
| Function |
Has steroid 11-beta-hydroxylase activity. In addition to this activity, the 18 or 19-hydroxylation of steroids and the aromatization of androstendione to estrone have also been ascribed to cytochrome P450 XIB.
Click to Show/Hide
|
|||||
| BioChemical Class |
Paired donor oxygen oxidoreductase
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 1.14.15.4
|
|||||
| Sequence |
MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQG
YEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYR QHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNA RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELS PDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATT ELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRP ERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQED IKMVYSFILRPSMFPLLTFRAIN Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| ADReCS ID | BADD_A06083 | |||||
| HIT2.0 ID | T10HXK | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 3 Approved Drugs | + | ||||
| 1 | FADROZOLE | Drug Info | Approved | Breast cancer | [2], [3], [4] | |
| 2 | Metyrapone | Drug Info | Approved | Cushing disease | [5], [6] | |
| 3 | Osilodrostat | Drug Info | Approved | Cushing disease | [7] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Inhibitor | [+] 150 Inhibitor drugs | + | ||||
| 1 | FADROZOLE | Drug Info | [8] | |||
| 2 | Metyrapone | Drug Info | [1] | |||
| 3 | (3-((1H-imidazol-1-yl)methyl)phenyl)methanol | Drug Info | [8] | |||
| 4 | (4-((1H-imidazol-1-yl)methyl)phenyl)methanol | Drug Info | [8] | |||
| 5 | 1-(2-Phenoxy-ethyl)-1H-imidazole | Drug Info | [9] | |||
| 6 | 1-(3,4-dihydronaphthalen-2-yl)-1H-imidazole | Drug Info | [10] | |||
| 7 | 1-(3-Bromobenzyl)-1H-imidazole | Drug Info | [8] | |||
| 8 | 1-(3-Chlorobenzyl)-1H-imidazole | Drug Info | [8] | |||
| 9 | 1-(3-Fluorobenzyl)-1H-imidazole | Drug Info | [8] | |||
| 10 | 1-(3-Methoxy-naphthalen-2-yl)-1H-imidazole | Drug Info | [11] | |||
| 11 | 1-(4-Aminobenzyl)-1H-imidazole | Drug Info | [8] | |||
| 12 | 1-(4-Bromobenzyl)-1H-imidazole | Drug Info | [8] | |||
| 13 | 1-(4-Bromobenzyl)-5-phenyl-1H-imidazole | Drug Info | [8] | |||
| 14 | 1-(4-Chlorobenzyl)-5-phenyl-1H-imidazole | Drug Info | [8] | |||
| 15 | 1-(4-Cyanobenzyl)-5-(2-fluorophenyl)-1H-imidazole | Drug Info | [8] | |||
| 16 | 1-(4-Cyanobenzyl)-5-(2-methylphenyl)-1H-imidazole | Drug Info | [8] | |||
| 17 | 1-(4-Cyanobenzyl)-5-(3-fluorophenyl)-1H-imidazole | Drug Info | [8] | |||
| 18 | 1-(4-Cyanobenzyl)-5-(3-methylphenyl)-1H-imidazole | Drug Info | [8] | |||
| 19 | 1-(4-Cyanobenzyl)-5-(4-fluorophenyl)-1H-imidazole | Drug Info | [8] | |||
| 20 | 1-(4-Cyanobenzyl)-5-(4-methylphenyl)-1H-imidazole | Drug Info | [8] | |||
| 21 | 1-(4-Cyanobenzyl)-5-(4-pyridyl)-1H-imidazole | Drug Info | [8] | |||
| 22 | 1-(4-Cyanobenzyl)-5-bromo-1H-imidazole | Drug Info | [8] | |||
| 23 | 1-(4-Cyanobenzyl)-5-formyl-1H-imidazole | Drug Info | [8] | |||
| 24 | 1-(4-Cyanobenzyl)-5-hydroxymethyl-1H-imidazole | Drug Info | [8] | |||
| 25 | 1-(4-Cyanobenzyl)-5-methyl-1H-imidazole | Drug Info | [8] | |||
| 26 | 1-(4-Cyanobenzyl)-5-phenyl-1H-imidazole | Drug Info | [8] | |||
| 27 | 1-(4-fluorobenzyl)-1H-imidazole | Drug Info | [8] | |||
| 28 | 1-(4-Fluorobenzyl)-5-phenyl-1H-imidazole | Drug Info | [8] | |||
| 29 | 1-(4-Methoxybenzyl)-5-phenyl-1H-imidazole | Drug Info | [8] | |||
| 30 | 1-(6-Methoxy-naphthalen-2-yl)-1H-imidazole | Drug Info | [11] | |||
| 31 | 1-Benzyl-5-phenyl-1H-imidazole | Drug Info | [8] | |||
| 32 | 1-Ethyl-3-imidazol-1-ylmethyl-1H-indole | Drug Info | [12] | |||
| 33 | 1-Naphthalen-2-yl-1H-imidazole | Drug Info | [11] | |||
| 34 | 1-Phenyl-2-pyridin-3-yl-propan-1-one | Drug Info | [13] | |||
| 35 | 2-Methyl-1,2-di-pyridin-3-yl-1-methoxypropane | Drug Info | [13] | |||
| 36 | 2-Methyl-1,2-di-pyridin-3-yl-propan-1-one oxime | Drug Info | [13] | |||
| 37 | 2-Methyl-1,2-di-pyridin-3-yl-propane | Drug Info | [13] | |||
| 38 | 2-Methyl-1,2-di-pyridin-3-yl-propylchloride | Drug Info | [13] | |||
| 39 | 2-Methyl-1,2-di-pyridin-3-yl-propyliodide | Drug Info | [13] | |||
| 40 | 2-Methyl-1-phenyl-2-pyridin-3-yl-propan-1-ol | Drug Info | [13] | |||
| 41 | 2-Methyl-1-phenyl-2-pyridin-3-yl-propan-1-one | Drug Info | [13] | |||
| 42 | 3-((1H-imidazol-1-yl)methyl)aniline | Drug Info | [8] | |||
| 43 | 3-(1,1-Dimethyl-2-phenyl-ethyl)-pyridine | Drug Info | [13] | |||
| 44 | 3-(1,2-dihydroacenaphthylen-3-yl)pyridine | Drug Info | [14] | |||
| 45 | 3-(1,2-dihydroacenaphthylen-5-yl)pyridine | Drug Info | [14] | |||
| 46 | 3-(1-Benzyl-1H-imidazol-5-yl)-1-propanol | Drug Info | [8] | |||
| 47 | 3-(1-Chloro-7-methoxy-naphthalen-2-yl)-pyridine | Drug Info | [11] | |||
| 48 | 3-(1-ethyl-3,4-dihydronaphthalen-2-yl)-pyridine | Drug Info | [10] | |||
| 49 | 3-(1-methyl-3,4-dihydronaphthalen-2-yl)-pyridine | Drug Info | [10] | |||
| 50 | 3-(1H-inden-2-yl)pyridine | Drug Info | [10] | |||
| 51 | 3-(2,3-Dihydro-1,4-benzodioxin-6-yl)pyridine | Drug Info | [15] | |||
| 52 | 3-(2-Chloro-1,1-dimethyl-2-phenyl-ethyl)-pyridine | Drug Info | [13] | |||
| 53 | 3-(3,4-dihydronaphthalen-2-yl)pyridine | Drug Info | [10] | |||
| 54 | 3-(3-Benzyl-6-methoxynaphthalen-2-yl)pyridine | Drug Info | [16] | |||
| 55 | 3-(3-Benzylnaphthalen-2-yl)pyridine | Drug Info | [16] | |||
| 56 | 3-(3-methyl-3,4-dihydronaphthalen-2-yl)pyridine | Drug Info | [10] | |||
| 57 | 3-(4-ethyl-3,4-dihydronaphthalen-2-yl)pyridine | Drug Info | [10] | |||
| 58 | 3-(4-methyl-3,4-dihydronaphthalen-2-yl)pyridine | Drug Info | [10] | |||
| 59 | 3-(5,6,7,8-Tetrahydronaphthalen-2-yl)pyridine | Drug Info | [15] | |||
| 60 | 3-(5-Bromo-6-methoxy-naphthalen-2-yl)-pyridine | Drug Info | [11] | |||
| 61 | 3-(5-Chloro-6-methoxy-naphthalen-2-yl)-pyridine | Drug Info | [11] | |||
| 62 | 3-(5-methoxy-1H-inden-2-yl)pyridine | Drug Info | [10] | |||
| 63 | 3-(6-Bromo-naphthalen-2-yl)-pyridine | Drug Info | [11] | |||
| 64 | 3-(6-Ethoxy-naphthalen-2-yl)-pyridine | Drug Info | [11] | |||
| 65 | 3-(6-methoxy-3,4-dihydronaphthalen-2-yl)pyridine | Drug Info | [17] | |||
| 66 | 3-(6-Methoxy-3-methylnaphthalen-2-yl)pyridine | Drug Info | [17] | |||
| 67 | 3-(6-Methoxynaphthalen-2-yl)-4-methylpyridine | Drug Info | [17] | |||
| 68 | 3-(6-Methoxynaphthalen-2-yl)-5-phenylpyridine | Drug Info | [17] | |||
| 69 | 3-(6-Methoxynaphthalen-2-yl)pyridin-4-amine | Drug Info | [17] | |||
| 70 | 3-(6-methoxynaphthalen-2-yl)pyridine | Drug Info | [16] | |||
| 71 | 3-(naphthalen-2-yl)pyridine | Drug Info | [16] | |||
| 72 | 3-Ethoxy-5-(6-methoxynaphthalen-2-yl)pyridine | Drug Info | [17] | |||
| 73 | 3-Fluoro-4'-(pyridin-4-ylmethyl)biphenyl-4-ol | Drug Info | [18] | |||
| 74 | 3-Imidazol-1-yl-quinoline | Drug Info | [11] | |||
| 75 | 3-Imidazol-1-ylmethyl-1H-indole | Drug Info | [12] | |||
| 76 | 3-Imidazol-1-ylmethyl-2-isopropyl-1H-indole | Drug Info | [12] | |||
| 77 | 3-Indan-(1E)-ylidenemethyl-pyridine | Drug Info | [19] | |||
| 78 | 3-Indan-(1Z)-ylidenemethyl-pyridine | Drug Info | [19] | |||
| 79 | 3-MeSO2-DDE | Drug Info | [1] | |||
| 80 | 3-methoxy-5-(6-methoxynaphthalen-2-yl)pyridine | Drug Info | [17] | |||
| 81 | 3-Phenanthren-9-yl-pyridine | Drug Info | [11] | |||
| 82 | 3-[(Z)-2-phenylvinyl]pyridine | Drug Info | [10] | |||
| 83 | 3-[1-(4-Bromobenzyl)-1H-imidazol-5-yl]-1-propanol | Drug Info | [8] | |||
| 84 | 3-[1-(4-Cyanobenzyl)-1H-imidazol-5-yl]-1-propanol | Drug Info | [8] | |||
| 85 | 3-[3-(4-Methoxybenzyl)naphthalen-2-yl]pyridine | Drug Info | [16] | |||
| 86 | 3-[4-Chloro-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 87 | 3-[4-Chloro-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 88 | 3-[4-Fluoro-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 89 | 3-[4-Methyl-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 90 | 3-[5-Bromo-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 91 | 3-[5-Bromo-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 92 | 3-[5-Chloro-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 93 | 3-[5-Chloro-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 94 | 3-[5-Ethoxy-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 95 | 3-[5-Ethoxy-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 96 | 3-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 97 | 3-[5-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 98 | 3-[5-Methoxy-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 99 | 3-[5-Methoxy-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 100 | 3-[7-Methoxy-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 101 | 4'-(Pyridin-4-ylmethyl)biphenyl-3,4-diamine | Drug Info | [18] | |||
| 102 | 4'-(Pyridin-4-ylmethyl)biphenyl-3,4-diol | Drug Info | [18] | |||
| 103 | 4'-(Pyridin-4-ylmethyl)biphenyl-3-amine | Drug Info | [18] | |||
| 104 | 4'-(Pyridin-4-ylmethyl)biphenyl-4-amine | Drug Info | [18] | |||
| 105 | 4-((1H-imidazol-1-yl)methyl)benzonitrile | Drug Info | [8] | |||
| 106 | 4-((3',4'-Difluorobiphenyl-4-yl)methyl)pyridine | Drug Info | [18] | |||
| 107 | 4-(2-Imidazol-1-yl-ethoxy)-benzamide | Drug Info | [9] | |||
| 108 | 4-(4'-Fluoro-biphenyl-4-ylmethyl)pyridine | Drug Info | [18] | |||
| 109 | 4-(4-(thiophen-2-yl)benzyl)pyridine | Drug Info | [18] | |||
| 110 | 4-(4-(thiophen-3-yl)benzyl)pyridine | Drug Info | [18] | |||
| 111 | 4-(6-methoxy-3,4-dihydronaphthalen-2-yl)pyridine | Drug Info | [10] | |||
| 112 | 4-(6-Methoxy-3-methylnaphthalen-2-yl)isoquinoline | Drug Info | [17] | |||
| 113 | 4-(6-Methoxynaphthalen-2-yl)isoquinoline | Drug Info | [17] | |||
| 114 | 4-Indan-(1Z)-ylidenemethyl-pyridine | Drug Info | [19] | |||
| 115 | 4-[(3'-Hydroxybiphenyl-4-yl)methyl]pyridine | Drug Info | [18] | |||
| 116 | 4-[(4'-Hydroxybiphenyl-4-yl)methyl]pyridine | Drug Info | [18] | |||
| 117 | 4-[5-Bromo-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 118 | 4-[5-Bromo-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 119 | 4-[5-Chloro-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 120 | 4-[5-Chloro-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 121 | 4-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 122 | 4-[5-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [19] | |||
| 123 | 5-(6-Methoxynaphthalen-2-yl)pyridin-3-ol | Drug Info | [17] | |||
| 124 | 5-Indan-(1E)-ylidenemethyl-1H-imidazole | Drug Info | [20] | |||
| 125 | 5-Indan-(1Z)-ylidenemethyl-1H-imidazole | Drug Info | [20] | |||
| 126 | 5-Naphthalen-2-yl-1H-imidazole | Drug Info | [11] | |||
| 127 | 5-Naphthalen-2-yl-oxazole | Drug Info | [11] | |||
| 128 | 5-Pyridin-3-yl-1,3-dihydro-2H-indol-2-one | Drug Info | [15] | |||
| 129 | 5-Pyridin-3-yl-2,3-dihydro-1H-inden-1-one | Drug Info | [15] | |||
| 130 | 5-[4-(Pyridin-4-ylmethyl)phenyl]-1H-indole | Drug Info | [18] | |||
| 131 | 5-[5-Bromo-indan-(1E)-ylidenemethyl]-1H-imidazole | Drug Info | [20] | |||
| 132 | 5-[5-Bromo-indan-(1Z)-ylidenemethyl]-1H-imidazole | Drug Info | [20] | |||
| 133 | 5-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyrimidine | Drug Info | [19] | |||
| 134 | 6-(4-Methylpyridin-3-yl)-2-naphthonitrile | Drug Info | [17] | |||
| 135 | 6-(pyridin-3-yl)-2-naphthonitrile | Drug Info | [17] | |||
| 136 | 6-Isoquinolin-4-yl-3,4-dihydroquinolin-2(1H)-one | Drug Info | [15] | |||
| 137 | 6-Pyridin-3-yl-1,2,3,4-tetrahydronaphthalen-2-ol | Drug Info | [15] | |||
| 138 | 6-Pyridin-3-yl-3,4-dihydro-1H-quinolin-2-one | Drug Info | [15] | |||
| 139 | 6-Pyridin-3-yl-3,4-dihydronaphthalen-2(1H)-one | Drug Info | [15] | |||
| 140 | 6-Pyridin-3-yl-3,4-dihydroquinoline-2(1H)-thione | Drug Info | [15] | |||
| 141 | 6-Pyridin-3-yl-naphthalen-2-ol | Drug Info | [11] | |||
| 142 | 6-[4-(Pyridin-4-ylmethyl)phenyl]naphthalen-2-ol | Drug Info | [18] | |||
| 143 | 7-(1-(1H-imidazol-1-yl)ethyl)-9H-fluoren-2-ol | Drug Info | [21] | |||
| 144 | 7-Pyridin-3-yl-2H-1,4-benzothiazin-3(4H)-one | Drug Info | [15] | |||
| 145 | BENZYLIMIDAZOLE | Drug Info | [8] | |||
| 146 | Methyl 3-(1-Benzyl-1H-imidazol-5-yl)-propanoate | Drug Info | [8] | |||
| 147 | METYRAPOL | Drug Info | [13] | |||
| 148 | N-(4'-Isonicotinoylbiphenyl-3-yl)acetamide | Drug Info | [18] | |||
| 149 | R-fadrozole | Drug Info | [8] | |||
| 150 | SL125 | Drug Info | [22] | |||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | Osilodrostat | Drug Info | [7] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| BioCyc | [+] 3 BioCyc Pathways | + | ||||
| 1 | Superpathway of steroid hormone biosynthesis | |||||
| 2 | Glucocorticoid biosynthesis | |||||
| 3 | Mineralocorticoid biosynthesis | |||||
| KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
| 1 | Steroid hormone biosynthesis | |||||
| 2 | Metabolic pathways | |||||
| Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
| 1 | Steroidogenesis | |||||
| Reactome | [+] 2 Reactome Pathways | + | ||||
| 1 | Glucocorticoid biosynthesis | |||||
| 2 | Endogenous sterols | |||||
| WikiPathways | [+] 4 WikiPathways | + | ||||
| 1 | Metapathway biotransformation | |||||
| 2 | Oxidation by Cytochrome P450 | |||||
| 3 | Metabolism of steroid hormones and vitamin D | |||||
| 4 | Corticotropin-releasing hormone | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Effects of 3-MeSO2-DDE and some CYP inhibitors on glucocorticoid steroidogenesis in the H295R human adrenocortical carcinoma cell line. Toxicol In Vitro. 2002 Apr;16(2):113-21. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8311). | |||||
| REF 3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000824) | |||||
| REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5224). | |||||
| REF 6 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 012911. | |||||
| REF 7 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2020 | |||||
| REF 8 | Synthesis, biological evaluation, and molecular modeling of 1-benzyl-1H-imidazoles as selective inhibitors of aldosterone synthase (CYP11B2). J Med Chem. 2010 Feb 25;53(4):1712-25. | |||||
| REF 9 | Selective thromboxane synthetase inhibitors. 1. 1-[(Aryloxy)alkyl]-1H-imidazoles. J Med Chem. 1985 Oct;28(10):1427-32. | |||||
| REF 10 | Synthesis and evaluation of heteroaryl-substituted dihydronaphthalenes and indenes: potent and selective inhibitors of aldosterone synthase (CYP11B... J Med Chem. 2006 Apr 6;49(7):2222-31. | |||||
| REF 11 | Heteroaryl-substituted naphthalenes and structurally modified derivatives: selective inhibitors of CYP11B2 for the treatment of congestive heart fa... J Med Chem. 2005 Oct 20;48(21):6632-42. | |||||
| REF 12 | Selective thromboxane synthetase inhibitors. 2. 3-(1H-imidazol-1-ylmethyl)-2-methyl-1H-indole-1-propanoic acid and analogues. J Med Chem. 1986 Mar;29(3):342-6. | |||||
| REF 13 | Structure-activity relationship study of the inhibition of adrenal cortical 11 beta-hydroxylase by new metyrapone analogues. J Med Chem. 1984 Jan;27(1):15-9. | |||||
| REF 14 | Development and evaluation of a pharmacophore model for inhibitors of aldosterone synthase (CYP11B2). Bioorg Med Chem Lett. 2006 Jan 1;16(1):25-30. | |||||
| REF 15 | In vivo active aldosterone synthase inhibitors with improved selectivity: lead optimization providing a series of pyridine substituted 3,4-dihydro-... J Med Chem. 2008 Dec 25;51(24):8077-87. | |||||
| REF 16 | Novel aldosterone synthase inhibitors with extended carbocyclic skeleton by a combined ligand-based and structure-based drug design approach. J Med Chem. 2008 Oct 9;51(19):6138-49. | |||||
| REF 17 | Overcoming undesirable CYP1A2 inhibition of pyridylnaphthalene-type aldosterone synthase inhibitors: influence of heteroaryl derivatization on pote... J Med Chem. 2008 Aug 28;51(16):5064-74. | |||||
| REF 18 | Replacement of imidazolyl by pyridyl in biphenylmethylenes results in selective CYP17 and dual CYP17/CYP11B1 inhibitors for the treatment of prosta... J Med Chem. 2010 Aug 12;53(15):5749-58. | |||||
| REF 19 | Synthesis and evaluation of (pyridylmethylene)tetrahydronaphthalenes/-indanes and structurally modified derivatives: potent and selective inhibitor... J Med Chem. 2005 Mar 10;48(5):1563-75. | |||||
| REF 20 | Synthesis and evaluation of imidazolylmethylenetetrahydronaphthalenes and imidazolylmethyleneindanes: potent inhibitors of aldosterone synthase. J Med Chem. 2005 Mar 24;48(6):1796-805. | |||||
| REF 21 | Synthesis, biological evaluation, and molecular modeling studies of methylene imidazole substituted biaryls as inhibitors of human 17alpha-hydroxyl... Bioorg Med Chem. 2008 Aug 15;16(16):7715-27. | |||||
| REF 22 | Reduction of cell proliferation induced by PD166866: an inhibitor of the basic fibroblast growth factor. J Exp Clin Cancer Res. 2007 Sep;26(3):405-9. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.