Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T07806
(Former ID: TTDS00099)
|
|||||
Target Name |
5-HT 1B receptor (HTR1B)
|
|||||
Synonyms |
Serotonin receptor 1B; Serotonin 1D beta receptor; S12; HTR1DB; 5-hydroxytryptamine receptor 1B; 5-HT1B receptor; 5-HT1B; 5-HT-1D-beta; 5-HT-1B
|
|||||
Gene Name |
HTR1B
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 4 Target-related Diseases | + | ||||
1 | Migraine [ICD-11: 8A80] | |||||
2 | Pituitary gland disorder [ICD-11: 5A60-5A61] | |||||
3 | Psychotic disorder [ICD-11: 6A20-6A25] | |||||
4 | Schizophrenia [ICD-11: 6A20] | |||||
Function |
Functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances, such as lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Regulates the release of 5-hydroxytryptamine, dopamine and acetylcholine in the brain, and thereby affects neural activity, nociceptive processing, pain perception, mood and behavior. Besides, plays a role in vasoconstriction of cerebral arteries. G-protein coupled receptor for 5-hydroxytryptamine (serotonin).
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL NSLINPIIYTMSNEDFKQAFHKLIRFKCTS Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T97ZTQ |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 7 Approved Drugs | + | ||||
1 | Eletriptan | Drug Info | Approved | Migraine | [2], [3] | |
2 | Fluphenazine | Drug Info | Approved | Psychotic disorder | [4], [5] | |
3 | Frovatriptan | Drug Info | Approved | Migraine | [3], [6] | |
4 | Metergolin | Drug Info | Approved | Hyperprolactinaemia | [7] | |
5 | Naratriptan | Drug Info | Approved | Migraine | [3], [8] | |
6 | Prolixin decanoate | Drug Info | Approved | Schizophrenia | [9] | |
7 | Zolmitriptan | Drug Info | Approved | Migraine | [10], [11] | |
Clinical Trial Drug(s) | [+] 3 Clinical Trial Drugs | + | ||||
1 | Eltoprazine | Drug Info | Phase 3 | Attention deficit hyperactivity disorder | [12] | |
2 | NXN-188 | Drug Info | Phase 2 | Migraine | [13] | |
3 | [N-methyl-3H(3)]AZ-10419369 | Drug Info | Phase 1 | Mood disorder | [14], [15] | |
Discontinued Drug(s) | [+] 9 Discontinued Drugs | + | ||||
1 | Alniditan | Drug Info | Discontinued in Phase 3 | Migraine | [16], [17] | |
2 | Elzasonan hydrochloride | Drug Info | Discontinued in Phase 2 | Mood disorder | [18] | |
3 | IS-159 | Drug Info | Discontinued in Phase 2 | Migraine | [19] | |
4 | Anpirtoline | Drug Info | Terminated | Pain | [22] | |
5 | AZD-1134 | Drug Info | Terminated | Anxiety disorder | [23] | |
6 | CGS-12066B | Drug Info | Terminated | Anxiety disorder | [24], [25] | |
7 | F-12682 | Drug Info | Terminated | Major depressive disorder | [26] | |
8 | GR-127935 | Drug Info | Terminated | Major depressive disorder | [27], [28] | |
9 | VR-147 | Drug Info | Terminated | Migraine | [29] | |
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | Donitriptan | Drug Info | Preclinical | Migraine | [20], [21] | |
Mode of Action | [+] 4 Modes of Action | + | ||||
Modulator | [+] 13 Modulator drugs | + | ||||
1 | Eletriptan | Drug Info | [30] | |||
2 | Fluphenazine | Drug Info | [30] | |||
3 | Frovatriptan | Drug Info | [30] | |||
4 | Prolixin decanoate | Drug Info | [30] | |||
5 | Zolmitriptan | Drug Info | [30] | |||
6 | NXN-188 | Drug Info | [34] | |||
7 | Elzasonan hydrochloride | Drug Info | [37] | |||
8 | IS-159 | Drug Info | [38] | |||
9 | Donitriptan | Drug Info | [39] | |||
10 | Anpirtoline | Drug Info | [22] | |||
11 | CGS-12066B | Drug Info | [41] | |||
12 | GR-127935 | Drug Info | [43] | |||
13 | VR-147 | Drug Info | [33], [45] | |||
Antagonist | [+] 15 Antagonist drugs | + | ||||
1 | Metergolin | Drug Info | [31] | |||
2 | [N-methyl-3H(3)]AZ-10419369 | Drug Info | [33], [35] | |||
3 | AZD-1134 | Drug Info | [33], [40] | |||
4 | F-12682 | Drug Info | [33], [42] | |||
5 | (R)-flurocarazolol | Drug Info | [47] | |||
6 | (S)-flurocarazolol | Drug Info | [47] | |||
7 | 5-OH-DPAT | Drug Info | [54] | |||
8 | 9-OH-risperidone | Drug Info | [56] | |||
9 | GR55562 | Drug Info | [60] | |||
10 | SB 224289 | Drug Info | [60] | |||
11 | SB 272183 | Drug Info | [62] | |||
12 | SB 649915 | Drug Info | [63] | |||
13 | SB 714786 | Drug Info | [63] | |||
14 | SB236057 | Drug Info | [64], [65] | |||
15 | [3H]GR 125,743 | Drug Info | [71] | |||
Agonist | [+] 20 Agonist drugs | + | ||||
1 | Naratriptan | Drug Info | [1] | |||
2 | Eltoprazine | Drug Info | [32], [33] | |||
3 | Alniditan | Drug Info | [36] | |||
4 | 1-naphthylpiperazine | Drug Info | [31] | |||
5 | 2-(5-Nonyloxy-1H-indol-3-yl)-ethylamine | Drug Info | [50] | |||
6 | 2-methyl-5-HT | Drug Info | [52] | |||
7 | 5-CT | Drug Info | [54] | |||
8 | 7-methoxy-1-naphthylpiperazine | Drug Info | [49] | |||
9 | BRL-15572 | Drug Info | [58] | |||
10 | CP-94,253 | Drug Info | [59] | |||
11 | dipropyl-5-CT | Drug Info | [52] | |||
12 | L-772,405 | Drug Info | [61] | |||
13 | lysergol | Drug Info | [31] | |||
14 | SB 216641 | Drug Info | [58] | |||
15 | TFMPP | Drug Info | [31] | |||
16 | [11C]AZ10419369 | Drug Info | [67] | |||
17 | [125I]GTI | Drug Info | [68] | |||
18 | [3H]8-OH-DPAT | Drug Info | [69] | |||
19 | [3H]eletriptan | Drug Info | [70] | |||
20 | [3H]sumatriptan | Drug Info | [70] | |||
Inhibitor | [+] 14 Inhibitor drugs | + | ||||
1 | L-775606 | Drug Info | [44] | |||
2 | (+/-)-nantenine | Drug Info | [46] | |||
3 | 1-(3-(pentafluorosulfanyl)phenyl)propan-2-amine | Drug Info | [48] | |||
4 | 1-(7-Methoxy-naphthalen-2-yl)-piperazine | Drug Info | [49] | |||
5 | 1-Naphthalen-2-yl-piperazine | Drug Info | [49] | |||
6 | 2-(5-Thiophen-2-yl-1H-indol-3-yl)-ethylamine | Drug Info | [51] | |||
7 | 5-amino-3-(N-methylpiperidin-4-yl)-1H-indole | Drug Info | [53] | |||
8 | 5-Ethyl-3-(2-pyrrolidin-1-yl-ethyl)-1H-indole | Drug Info | [55] | |||
9 | 5-Isopropyl-3-(2-pyrrolidin-1-yl-ethyl)-1H-indole | Drug Info | [55] | |||
10 | A-987306 | Drug Info | [57] | |||
11 | L-747201 | Drug Info | [44] | |||
12 | SEROTONIN | Drug Info | [57] | |||
13 | WAY-466 | Drug Info | [66] | |||
14 | [2-(5-Ethyl-1H-indol-3-yl)-ethyl]-dimethyl-amine | Drug Info | [55] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
1 | cAMP signaling pathway | |||||
2 | Neuroactive ligand-receptor interaction | |||||
3 | Serotonergic synapse | |||||
Panther Pathway | [+] 2 Panther Pathways | + | ||||
1 | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
2 | 5HT1 type receptor mediated signaling pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Serotonin receptors | |||||
2 | G alpha (i) signalling events | |||||
WikiPathways | [+] 5 WikiPathways | + | ||||
1 | Serotonin HTR1 Group and FOS Pathway | |||||
2 | Monoamine GPCRs | |||||
3 | GPCRs, Class A Rhodopsin-like | |||||
4 | GPCR ligand binding | |||||
5 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Triptans in pregnancy. Ther Drug Monit. 2008 Feb;30(1):5-9. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 40). | |||||
REF 3 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | |||||
REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 204). | |||||
REF 5 | The antipsychotic drug, fluphenazine, effectively reverses mechanical allodynia in rat models of neuropathic pain. Psychopharmacology (Berl). 2008 Jan;195(4):559-68. | |||||
REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7191). | |||||
REF 7 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 8 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 45). | |||||
REF 9 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016727. | |||||
REF 10 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 60). | |||||
REF 11 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 020768. | |||||
REF 12 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 13 | ClinicalTrials.gov (NCT00920686) Study of NXN 188 for the Treatment of Migraine With Aura. U.S. National Institutes of Health. | |||||
REF 14 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3219). | |||||
REF 15 | ClinicalTrials.gov (NCT01085123) Determine Central 5-HT1B Receptor Occupancy of ZOMIG Rapimelt (Zolmitriptan) in Healthy Male Volunteers. U.S. National Institutes of Health. | |||||
REF 16 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 120). | |||||
REF 17 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006286) | |||||
REF 18 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. | |||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005786) | |||||
REF 20 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 39). | |||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012002) | |||||
REF 22 | Effects of anpirtoline on regional serotonin synthesis in the rat brain: an autoradiographic study. Nucl Med Biol. 2006 Apr;33(3):325-32. | |||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017898) | |||||
REF 24 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 109). | |||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006033) | |||||
REF 26 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010898) | |||||
REF 27 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 14). | |||||
REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002743) | |||||
REF 29 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023937) | |||||
REF 30 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
REF 31 | Two amino acid differences in the sixth transmembrane domain are partially responsible for the pharmacological differences between the 5-HT1D beta and 5-HT1E 5-hydroxytryptamine receptors. J Neurochem. 1996 Nov;67(5):2096-103. | |||||
REF 32 | Clinical pipeline report, company report or official report of Jazz Pharmaceuticals. | |||||
REF 33 | Sustained pain relief with dihydroergotamine in migraine is potentially due to persistent binding to 5-HT1B and 5-HT1D receptors. . The Journal of Headache and Pain 201314(Suppl 1):P75. | |||||
REF 34 | Company report (NeurAxon) | |||||
REF 35 | 5-HT1B and other related serotonergic proteins are altered in APPswe mutation. Neurosci Lett. 2015 May 6;594:137-43. | |||||
REF 36 | Agonistic properties of alniditan, sumatriptan and dihydroergotamine on human 5-HT1B and 5-HT1D receptors expressed in various mammalian cell lines. Br J Pharmacol. 1998 Apr;123(8):1655-65. | |||||
REF 37 | DOI: 10.1002/9781118541203.xen439 | |||||
REF 38 | Pronounced effect of caprylocaproyl macrogolglycerides on nasal absorption of IS-159, a peptide serotonin 1B/1D-receptor agonist. Clin Pharmacol Ther. 2000 Aug;68(2):114-21. | |||||
REF 39 | Donitriptan, but not sumatriptan, inhibits capsaicin-induced canine external carotid vasodilatation via 5-HT1B rather than 5-HT1D receptors.Br J Pharmacol.2006 Sep;149(1):82-91. | |||||
REF 40 | N-methyl-3H3AZ10419369 binding to the 5-HT1B receptor: in vitro characterization and in vivo receptor occupancy. J Pharmacol Exp Ther. 2009 Jul;330(1):342-51. | |||||
REF 41 | Biochemical and pharmacological characterization of CGS 12066B, a selective serotonin-1B agonist. Eur J Pharmacol. 1987 Apr 7;136(1):1-9. | |||||
REF 42 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010898) | |||||
REF 43 | GR127935: a potent and selective 5-HT1D receptor antagonist.Behav Brain Res.1996;73(1-2):157-61. | |||||
REF 44 | Selective, orally active 5-HT1D receptor agonists as potential antimigraine agents. J Med Chem. 1997 Oct 24;40(22):3501-3. | |||||
REF 45 | US patent application no. 2010,0112,050, Dosage form for insertion into the mouth. | |||||
REF 46 | Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. | |||||
REF 47 | The in vitro pharmacology of the beta-adrenergic receptor pet ligand (s)-fluorocarazolol reveals high affinity for cloned beta-adrenergic receptors and moderate affinity for the human 5-HT1A receptor. Psychopharmacology (Berl). 2001 Aug;157(1):111-4. | |||||
REF 48 | The synthesis and biological activity of pentafluorosulfanyl analogs of fluoxetine, fenfluramine, and norfenfluramine. Bioorg Med Chem. 2007 Nov 1;15(21):6659-66. | |||||
REF 49 | 5-HT1B receptor antagonist properties of novel arylpiperazide derivatives of 1-naphthylpiperazine. J Med Chem. 1997 Nov 21;40(24):3974-8. | |||||
REF 50 | Identification of an amino acid residue important for binding of methiothepin and sumatriptan to the human 5-HT(1B) receptor. Eur J Pharmacol. 1999 Sep 10;380(2-3):171-81. | |||||
REF 51 | 5-Thienyltryptamine derivatives as serotonin 5-HT1B/1D receptor agonists: potential treatments for migraine. Bioorg Med Chem Lett. 2000 May 1;10(9):903-5. | |||||
REF 52 | Human serotonin 1D receptor is encoded by a subfamily of two distinct genes: 5-HT1D alpha and 5-HT1D beta. Proc Natl Acad Sci U S A. 1992 Apr 15;89(8):3630-4. | |||||
REF 53 | Designing selective, high affinity ligands of 5-HT1D receptor by covalent dimerization of 5-HT1F ligands derived from 4-fluoro-N-[3-(1-methyl-4-pip... J Med Chem. 2008 Jun 26;51(12):3609-16. | |||||
REF 54 | Mouse 5HT1B serotonin receptor: cloning, functional expression, and localization in motor control centers. Proc Natl Acad Sci U S A. 1992 Apr 1;89(7):3020-4. | |||||
REF 55 | 5-Alkyltryptamine derivatives as highly selective and potent 5-HT1D receptor agonists. Bioorg Med Chem Lett. 2000 Aug 7;10(15):1707-9. | |||||
REF 56 | Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl). 1996 Mar;124(1-2):57-73. | |||||
REF 57 | cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain... J Med Chem. 2008 Nov 27;51(22):7094-8. | |||||
REF 58 | SB-216641 and BRL-15572--compounds to pharmacologically discriminate h5-HT1B and h5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1997 Sep;356(3):312-20. | |||||
REF 59 | Anxiogenic-like effect of serotonin(1B) receptor stimulation in the rat elevated plus-maze. Pharmacol Biochem Behav. 2002 Apr;71(4):581-7. | |||||
REF 60 | 5-hydroxytryptamine receptors mediating contraction in human small muscular pulmonary arteries: importance of the 5-HT1B receptor. Br J Pharmacol. 1999 Oct;128(3):730-4. | |||||
REF 61 | 3-[3-(Piperidin-1-yl)propyl]indoles as highly selective h5-HT(1D) receptor agonists. J Med Chem. 1999 Dec 2;42(24):4981-5001. | |||||
REF 62 | SB-272183, a selective 5-HT(1A), 5-HT(1B) and 5-HT(1D) receptor antagonist in native tissue. Br J Pharmacol. 2001 Jul;133(6):797-806. | |||||
REF 63 | Discovery of the first potent, selective 5-hydroxytryptamine1D receptor antagonist. J Med Chem. 2005 May 19;48(10):3478-80. | |||||
REF 64 | SB-236057, a selective 5-HT1B receptor inverse agonist, blocks the 5-HT human terminal autoreceptor. Eur J Pharmacol. 1999 Jun 30;375(1-3):359-65. | |||||
REF 65 | SB-236057-A: a selective 5-HT1B receptor inverse agonist. CNS Drug Rev. 2001 Winter;7(4):433-44. | |||||
REF 66 | Discovery of 5-arylsulfonamido-3-(pyrrolidin-2-ylmethyl)-1H-indole derivatives as potent, selective 5-HT6 receptor agonists and antagonists. J Med Chem. 2005 Jan 27;48(2):353-6. | |||||
REF 67 | Quantitative analysis of [11C]AZ10419369 binding to 5-HT1B receptors in human brain. J Cereb Blood Flow Metab. 2011 Jan;31(1):113-23. | |||||
REF 68 | Autoradiographic characterisation and localisation of 5-HT1D compared to 5-HT1B binding sites in rat brain. Naunyn Schmiedebergs Arch Pharmacol. 1993 Jun;347(6):569-82. | |||||
REF 69 | Actions of roxindole at recombinant human dopamine D2, D3 and D4 and serotonin 5-HT1A, 5-HT1B and 5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1999 Jun;359(6):447-53. | |||||
REF 70 | Characterisation of the 5-HT receptor binding profile of eletriptan and kinetics of [3H]eletriptan binding at human 5-HT1B and 5-HT1D receptors. Eur J Pharmacol. 1999 Mar 5;368(2-3):259-68. | |||||
REF 71 | Serotonin 5-HT1B and 5-HT1D receptors form homodimers when expressed alone and heterodimers when co-expressed. FEBS Lett. 1999 Jul 30;456(1):63-7. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.