Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T01777
(Former ID: TTDR01180)
|
|||||
Target Name |
Adrenergic receptor alpha-2C (ADRA2C)
|
|||||
Synonyms |
Subtype C4; Alpha-2CAR; Alpha-2C adrenoreceptor; Alpha-2C adrenoceptor; Alpha-2C adrenergic receptor; Alpha-2 adrenergic receptor subtype C4; ADRA2RL2; ADRA2L2
|
|||||
Gene Name |
ADRA2C
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 6 Target-related Diseases | + | ||||
1 | Glaucoma [ICD-11: 9C61] | |||||
2 | Herpes simplex infection [ICD-11: 1F00] | |||||
3 | Hypertension [ICD-11: BA00-BA04] | |||||
4 | Hypotension [ICD-11: BA20-BA21] | |||||
5 | Obesity [ICD-11: 5B80-5B81] | |||||
6 | Substance abuse [ICD-11: 6C40] | |||||
Function |
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 9 Approved Drugs | + | ||||
1 | Amezinium | Drug Info | Approved | Hypotension | [2] | |
2 | Amosulalol | Drug Info | Approved | Hypertension | [1] | |
3 | Brimonidine | Drug Info | Approved | Ocular hypertension | [3], [4] | |
4 | Dihydroergocristine | Drug Info | Approved | Alcohol dependence | [5], [6] | |
5 | MOXONIDINE | Drug Info | Approved | Alcohol dependence | [7] | |
6 | Propylhexedrine | Drug Info | Approved | Obesity | [2] | |
7 | Rilmenidine | Drug Info | Approved | Hypertension | [2] | |
8 | Tetrahydrozoline | Drug Info | Approved | Ocular disease | [8] | |
9 | Xylometazoline | Drug Info | Phase 4 | Allergic rhinitis | [9], [10] | |
Clinical Trial Drug(s) | [+] 8 Clinical Trial Drugs | + | ||||
1 | IDAZOXAN HYDROCHLORIDE | Drug Info | Phase 3 | Neurological disorder | [11] | |
2 | TNX-102 | Drug Info | Phase 3 | Fibromyalgia | [12] | |
3 | AGN-XX/YY | Drug Info | Phase 2 | Fibromyalgia | [13] | |
4 | BAY1193397 | Drug Info | Phase 2 | Peripheral arterial disease | [14] | |
5 | Fadolmidine | Drug Info | Phase 2 | Neuropathic pain | [15] | |
6 | MEDETOMIDINE | Drug Info | Phase 2 | Pain | [16] | |
7 | ORM-12741 | Drug Info | Phase 2 | Alzheimer disease | [17] | |
8 | V-101 | Drug Info | Phase 2 | Erythema | [18] | |
Discontinued Drug(s) | [+] 15 Discontinued Drugs | + | ||||
1 | INDORAMIN | Drug Info | Withdrawn from market | Hypertension | [2], [19] | |
2 | Ecabapide | Drug Info | Discontinued in Preregistration | Peptic ulcer | [20] | |
3 | Delequamine hydrochloride | Drug Info | Discontinued in Phase 3 | Male sexual disorder | [21] | |
4 | FLUPAROXAN | Drug Info | Discontinued in Phase 3 | Depression | [22], [23] | |
5 | NOLOMIROLE HYDROCHLORIDE | Drug Info | Discontinued in Phase 3 | Heart failure | [24] | |
6 | Deriglidole | Drug Info | Discontinued in Phase 2 | Diabetic complication | [25] | |
7 | GYKI-16084 | Drug Info | Discontinued in Phase 2 | Prostate disease | [26] | |
8 | JTH-601 | Drug Info | Discontinued in Phase 2 | Prostate disease | [27] | |
9 | NMI-870 | Drug Info | Discontinued in Phase 2 | Sexual dysfunction | [28] | |
10 | SGB-1534 | Drug Info | Discontinued in Phase 2 | Hypotension | [29] | |
11 | GYKI-12743 | Drug Info | Discontinued in Phase 1 | Hypertension | [30] | |
12 | A-75169 | Drug Info | Terminated | Glaucoma/ocular hypertension | [32] | |
13 | F-14413 | Drug Info | Terminated | Alzheimer disease | [33] | |
14 | Midaglizole | Drug Info | Terminated | Asthma | [34] | |
15 | SNAP-5089 | Drug Info | Terminated | Heart arrhythmia | [35], [36] | |
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | 5-(N,N-hexamethylene)-amiloride | Drug Info | Preclinical | Coronavirus infection | [31] | |
Mode of Action | [+] 5 Modes of Action | + | ||||
Modulator | [+] 21 Modulator drugs | + | ||||
1 | Amezinium | Drug Info | [2], [37] | |||
2 | Amosulalol | Drug Info | [1], [2] | |||
3 | Brimonidine | Drug Info | [3] | |||
4 | Dihydroergocristine | Drug Info | [2], [6] | |||
5 | Propylhexedrine | Drug Info | [2], [39] | |||
6 | Rilmenidine | Drug Info | [2], [40] | |||
7 | Tetrahydrozoline | Drug Info | [2], [8] | |||
8 | Xylometazoline | Drug Info | [2], [41] | |||
9 | IDAZOXAN HYDROCHLORIDE | Drug Info | [42] | |||
10 | Ecabapide | Drug Info | [50] | |||
11 | Delequamine hydrochloride | Drug Info | [51] | |||
12 | FLUPAROXAN | Drug Info | [52] | |||
13 | NOLOMIROLE HYDROCHLORIDE | Drug Info | [53] | |||
14 | Deriglidole | Drug Info | [54] | |||
15 | NMI-870 | Drug Info | [59] | |||
16 | SGB-1534 | Drug Info | [60] | |||
17 | GYKI-12743 | Drug Info | [61] | |||
18 | A-75169 | Drug Info | [63] | |||
19 | Midaglizole | Drug Info | [67] | |||
20 | ETHOXY-IDAZOXAN | Drug Info | [91] | |||
21 | V-103 | Drug Info | [98] | |||
Inhibitor | [+] 60 Inhibitor drugs | + | ||||
1 | MOXONIDINE | Drug Info | [38] | |||
2 | MEDETOMIDINE | Drug Info | [46] | |||
3 | INDORAMIN | Drug Info | [49] | |||
4 | MAZAPERTINE | Drug Info | [57] | |||
5 | A-80426 | Drug Info | [64] | |||
6 | SK&F-104078 | Drug Info | [49] | |||
7 | SNAP-5089 | Drug Info | [68] | |||
8 | WB-4101 | Drug Info | [69] | |||
9 | (+/-)-nantenine | Drug Info | [70] | |||
10 | (1,2,3,4-Tetrahydro-isoquinolin-3-yl)-methanol | Drug Info | [71] | |||
11 | (1H-Benzoimidazol-5-yl)-(1H-imidazol-2-yl)-amine | Drug Info | [72] | |||
12 | (1H-Imidazol-2-yl)-quinoxalin-6-yl-amine | Drug Info | [72] | |||
13 | (2,6-Dichloro-phenyl)-(1H-imidazol-2-yl)-amine | Drug Info | [72] | |||
14 | (2-Bromo-phenyl)-(1H-imidazol-2-yl)-amine | Drug Info | [72] | |||
15 | (2-Methyl-indol-1-yl)-propyl-pyridin-4-yl-amine | Drug Info | [73] | |||
16 | (3-Ethyl-indol-1-yl)-propyl-pyridin-4-yl-amine | Drug Info | [73] | |||
17 | (3-Methyl-indol-1-yl)-propyl-pyridin-4-yl-amine | Drug Info | [73] | |||
18 | (R)-3-Methyl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [74] | |||
19 | (S)-3-Methyl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [74] | |||
20 | 1,2,3,4,4a,5,10,10a-Octahydro-benzo[g]quinoline | Drug Info | [75] | |||
21 | 1,2,3,4,5,6-Hexahydro-benzo[c]azocine | Drug Info | [74] | |||
22 | 1,2,3,4-Tetrahydro-benzo[h]isoquinolin-8-ol | Drug Info | [76] | |||
23 | 1,2,3,4-Tetrahydro-isoquinolin-7-ol | Drug Info | [76] | |||
24 | 1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole | Drug Info | [77] | |||
25 | 1,2,3,4-tetrahydroisoquinoline | Drug Info | [78] | |||
26 | 1-((S)-2-aminopropyl)-1H-indazol-6-ol | Drug Info | [79] | |||
27 | 2,3,4,5-Tetrahydro-1H-benzo[c]azepine | Drug Info | [74] | |||
28 | 2,3,4,5-Tetrahydro-1H-benzo[e][1,4]diazepine | Drug Info | [74] | |||
29 | 2,3,4,5-Tetrahydro-benzo[f][1,4]oxazepine | Drug Info | [74] | |||
30 | 2,3-Dihydro-1H-isoindole | Drug Info | [74] | |||
31 | 2-BFi | Drug Info | [80] | |||
32 | 3-Fluoromethyl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [81] | |||
33 | 3-Methoxymethyl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [71] | |||
34 | 3-Methyl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [74] | |||
35 | 4-(1-Naphthalen-1-yl-ethyl)-1H-imidazole | Drug Info | [46] | |||
36 | 4-(4-Methyl-indan-1-yl)-1H-imidazole | Drug Info | [82] | |||
37 | 5-Aminomethyl-naphthalen-2-ol | Drug Info | [76] | |||
38 | 6,7,8,9-Tetrahydro-5-thia-8-aza-benzocycloheptene | Drug Info | [74] | |||
39 | 7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [85] | |||
40 | 8-Methoxy-1,2,3,4-tetrahydro-benzo[h]isoquinoline | Drug Info | [76] | |||
41 | Butyl-indol-1-yl-pyridin-4-yl-amine | Drug Info | [73] | |||
42 | C-(6-Methoxy-naphthalen-1-yl)-methylamine | Drug Info | [76] | |||
43 | C-Naphthalen-1-yl-methylamine | Drug Info | [76] | |||
44 | CONESSINE | Drug Info | [90] | |||
45 | Ethyl-indol-1-yl-pyridin-4-yl-amine | Drug Info | [73] | |||
46 | GNF-PF-2857 | Drug Info | [92] | |||
47 | GNF-PF-3878 | Drug Info | [92] | |||
48 | Indol-1-yl-methyl-pyridin-4-yl-amine | Drug Info | [73] | |||
49 | Indol-1-yl-prop-2-ynyl-pyridin-4-yl-amine | Drug Info | [73] | |||
50 | Indol-1-yl-pyridin-4-yl-amine | Drug Info | [73] | |||
51 | METHYLNORADRENALINE | Drug Info | [69] | |||
52 | MEZILAMINE | Drug Info | [94] | |||
53 | PIPEROXAN | Drug Info | [69] | |||
54 | R-226161 | Drug Info | [96] | |||
55 | S-34324 | Drug Info | [64] | |||
56 | SK&F-64139 | Drug Info | [78] | |||
57 | SNAP-5150 | Drug Info | [68] | |||
58 | TRACIZOLINE | Drug Info | [85] | |||
59 | Tramazoline | Drug Info | [69] | |||
60 | TRYPTOLINE | Drug Info | [85] | |||
Antagonist | [+] 18 Antagonist drugs | + | ||||
1 | TNX-102 | Drug Info | [43] | |||
2 | BAY1193397 | Drug Info | [14] | |||
3 | ORM-12741 | Drug Info | [47] | |||
4 | GYKI-16084 | Drug Info | [55] | |||
5 | JTH-601 | Drug Info | [56] | |||
6 | MK-912 | Drug Info | [58] | |||
7 | ARC239 | Drug Info | [65] | |||
8 | F-14413 | Drug Info | [66] | |||
9 | 5-methylurapidil | Drug Info | [83] | |||
10 | all-trans-4-oxo-retinoic acid | Drug Info | [87] | |||
11 | Ciproxifan | Drug Info | [89] | |||
12 | JP1302 | Drug Info | [92], [93] | |||
13 | piribedil | Drug Info | [95] | |||
14 | spiroxatrine | Drug Info | [97] | |||
15 | [125I]BE-2254 | Drug Info | [100] | |||
16 | [3H]MK-912 | Drug Info | [102] | |||
17 | [3H]rauwolscine | Drug Info | [103] | |||
18 | [3H]RX821002 | Drug Info | [104], [105] | |||
Agonist | [+] 12 Agonist drugs | + | ||||
1 | AGN-XX/YY | Drug Info | [44] | |||
2 | Fadolmidine | Drug Info | [45] | |||
3 | V-101 | Drug Info | [48] | |||
4 | 6-fluoro-noradrenaline | Drug Info | [84] | |||
5 | A61603 | Drug Info | [86] | |||
6 | amidephrine | Drug Info | [84] | |||
7 | Chloroethylclonidine | Drug Info | [88] | |||
8 | cirazoline | Drug Info | [84] | |||
9 | indanidine | Drug Info | [84] | |||
10 | SKF 89748 | Drug Info | [84] | |||
11 | xylazine | Drug Info | [99] | |||
12 | [125I]HEAT | Drug Info | [101] | |||
Modulator (allosteric modulator) | [+] 1 Modulator (allosteric modulator) drugs | + | ||||
1 | 5-(N,N-hexamethylene)-amiloride | Drug Info | [62] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
1 | cGMP-PKG signaling pathway | |||||
2 | Neuroactive ligand-receptor interaction | |||||
Panther Pathway | [+] 2 Panther Pathways | + | ||||
1 | Alpha adrenergic receptor signaling pathway | |||||
2 | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
Reactome | [+] 6 Reactome Pathways | + | ||||
1 | Adrenoceptors | |||||
2 | Adrenaline signalling through Alpha-2 adrenergic receptor | |||||
3 | Adrenaline,noradrenaline inhibits insulin secretion | |||||
4 | G alpha (i) signalling events | |||||
5 | G alpha (z) signalling events | |||||
6 | Surfactant metabolism | |||||
WikiPathways | [+] 6 WikiPathways | + | ||||
1 | Monoamine GPCRs | |||||
2 | GPCRs, Class A Rhodopsin-like | |||||
3 | Platelet Aggregation (Plug Formation) | |||||
4 | Integration of energy metabolism | |||||
5 | GPCR ligand binding | |||||
6 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Effects of amosulalol, a combined alpha 1- and beta-adrenoceptor-blocking agent, on ischemic myocardial energy metabolism in dogs. J Pharm Sci. 1993 Mar;82(3):291-5. | |||||
REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 3 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 520). | |||||
REF 4 | ClinicalTrials.gov (NCT00675207) Comparison of Brimonidine Purite, Dorzolamide, and Brinzolamide as Adjunctive Therapy to Prostaglandin Analogs. U.S. National Institutes of Health. | |||||
REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 278). | |||||
REF 6 | Effect of dihydroergocristine on blood pressure and activity at peripheral alpha-adrenoceptors in pithed rats. Eur J Pharmacol. 1984 Jan 13;97(1-2):21-7. | |||||
REF 7 | The role of I(1)-imidazoline and alpha(2)-adrenergic receptors in the modulation of glucose metabolism in the spontaneously hypertensive obese rat ... J Pharmacol Exp Ther. 2003 Aug;306(2):646-57. | |||||
REF 8 | Prolonged cardiovascular effects after unintentional ingestion of tetrahydrozoline. Clin Toxicol (Phila). 2008 Feb;46(2):171-2. | |||||
REF 9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 517). | |||||
REF 10 | ClinicalTrials.gov (NCT00630474) Nasal Decongestion and Obstructive Sleep Apnea. U.S. National Institutes of Health. | |||||
REF 11 | ClinicalTrials.gov (NCT00294944) The Effectiveness of Idazoxan in Treating TRD. U.S. National Institutes of Health. | |||||
REF 12 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017946) | |||||
REF 13 | Clinical pipeline report, company report or official report of ACADIA Pharmaceuticals. | |||||
REF 14 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 15 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 16 | Sedative and cardiopulmonary effects of medetomidine hydrochloride and xylazine hydrochloride and their reversal with atipamezole hydrochloride in calves. Am J Vet Res. 2008 Mar;69(3):319-29. | |||||
REF 17 | ClinicalTrials.gov (NCT02471196) Efficacy of ORM-12741 on Agitation/Aggression Symptoms in Alzheimer's Disease. | |||||
REF 18 | ClinicalTrials.gov (NCT01186068) Dose Response Study of Patients With Erythematous Rosacea. U.S. National Institutes of Health. | |||||
REF 19 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 501). | |||||
REF 20 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000582) | |||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008832) | |||||
REF 22 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 41). | |||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000678) | |||||
REF 24 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003364) | |||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000010) | |||||
REF 26 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010746) | |||||
REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010685) | |||||
REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014166) | |||||
REF 29 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000148) | |||||
REF 30 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002059) | |||||
REF 31 | Coronaviruses - drug discovery and therapeutic options. Nat Rev Drug Discov. 2016 May;15(5):327-47. | |||||
REF 32 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003469) | |||||
REF 33 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019997) | |||||
REF 34 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000085) | |||||
REF 35 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 498). | |||||
REF 36 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006771) | |||||
REF 37 | Pharmacology of amezinium, a novel antihypotensive drug. III. Studies on the mechanism of action. Arzneimittelforschung. 1981;31(9a):1558-65. | |||||
REF 38 | Synthesis and pharmacologic evaluation of 2-endo-amino-3-exo-isopropylbicyclo[2.2.1]heptane: a potent imidazoline1 receptor specific agent. J Med Chem. 1996 Mar 15;39(6):1193-5. | |||||
REF 39 | Airway compromise and delayed death following attempted central vein injection of propylhexedrine. J Emerg Med. 1994 Nov-Dec;12(6):795-7. | |||||
REF 40 | Rilmenidine-induced ocular hypotension: role of imidazoline1 and alpha 2 receptors. Curr Eye Res. 1996 Sep;15(9):943-50. | |||||
REF 41 | Alpha-adrenoceptor agonistic activity of oxymetazoline and xylometazoline. Fundam Clin Pharmacol. 2010 Dec;24(6):729-39. | |||||
REF 42 | Different sites of action for alpha 2-adrenoceptor antagonists in the modulation of noradrenaline release and contraction response in the vas deferens of the rat. J Pharm Pharmacol. 1992 Mar;44(3):231-4. | |||||
REF 43 | Clinical pipeline report, company report or official report of Tonix Pharmaceuticals. | |||||
REF 44 | Patent WO2008058220 A2. | |||||
REF 45 | Antinociceptive properties of fadolmidine (MPV-2426), a novel alpha2-adrenoceptor agonist. CNS Drug Rev. 2004 Summer;10(2):117-26. | |||||
REF 46 | A structure-activity relationship study of benzylic modifications of 4-[1-(1-naphthyl)ethyl]-1H-imidazoles on alpha 1- and alpha 2-adrenergic recep... J Med Chem. 1994 Jul 22;37(15):2328-33. | |||||
REF 47 | A double-blind, randomized, placebo-controlled crossover trial of the alpha2C-adrenoceptor antagonist ORM-12741 for prevention of cold-induced vasospasm in patients with systemic sclerosis. Rheumatology (Oxford). 2014 May;53(5):948-52. | |||||
REF 48 | Rosacea: update on management and emerging therapies. Skin Therapy Lett. 2012 Dec;17(10):1-4. | |||||
REF 49 | Alpha- and beta-adrenoceptors: from the gene to the clinic. 1. Molecular biology and adrenoceptor subclassification. J Med Chem. 1995 Sep 1;38(18):3415-44. | |||||
REF 50 | Identification of major biliary and urinary metabolites of ecabapide in rats. Xenobiotica. 1996 Sep;26(9):983-94. | |||||
REF 51 | Modulation of sexual behaviour in the rat by a potent and selective alpha 2-adrenoceptor antagonist, delequamine (RS-15385-197). Br J Pharmacol. 1996 May;118(1):63-72. | |||||
REF 52 | The pharmacology of fluparoxan: a selective alpha 2-adrenoceptor antagonist. Br J Pharmacol. 1991 Apr;102(4):887-95. | |||||
REF 53 | Effect of nolomirole on monocrotaline-induced heart failure. Pharmacol Res. 2004 Jan;49(1):1-5. | |||||
REF 54 | Mechanisms of the hypoglycemic effects of the alpha2-adrenoceptor antagonists SL84.0418 and deriglidole. Life Sci. 1998;62(9):839-52. | |||||
REF 55 | A novel approach to the treatment of benign prostatic hyperplasia. BJU Int. 2006 Jun;97(6):1252-5. | |||||
REF 56 | Effect of JTH-601, a novel alpha(1)-adrenoceptor antagonist, on prostate function in dogs. Eur J Pharmacol. 2000 Apr 7;394(1):123-30. | |||||
REF 57 | A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem. 1994 Apr 15;37(8):1060-2. | |||||
REF 58 | Silent alpha(2C)-adrenergic receptors enable cold-induced vasoconstriction in cutaneous arteries. Am J Physiol Heart Circ Physiol. 2000 Apr;278(4):H1075-83. | |||||
REF 59 | Female Sexual Dysfunction: Therapeutic Options and Experimental Challenges. Cardiovasc Hematol Agents Med Chem. 2009 October; 7(4): 260-269. | |||||
REF 60 | Potent alpha-adrenoceptor blocking action of SGB-1534, a new quinazoline antihypertensive agent in vitro experiments. Gen Pharmacol. 1986;17(2):143-9. | |||||
REF 61 | GYKI-12743 a new postsynaptic vascular alpha-adrenoceptor antagonist. Acta Physiol Hung. 1991;77(3-4):257-67. | |||||
REF 62 | Characterization of the allosteric interactions between antagonists and amiloride analogues at the human alpha2A-adrenergic receptor. Mol Pharmacol. 1998 May;53(5):916-25. | |||||
REF 63 | A-75169 HCI: Pharmacological profile and ocular pharmacology studies of a new alpha-2 antagonist. Drug Development Research Volume 28, Issue 1, pages 56-64, January 1993. | |||||
REF 64 | Discovery of a new series of centrally active tricyclic isoxazoles combining serotonin (5-HT) reuptake inhibition with alpha2-adrenoceptor blocking... J Med Chem. 2005 Mar 24;48(6):2054-71. | |||||
REF 65 | Potent alpha(2A)-adrenoceptor-mediated vasoconstriction by brimonidine in porcine ciliary arteries. Invest Ophthalmol Vis Sci. 2001 Aug;42(9):2049-55. | |||||
REF 66 | Activation of noradrenergic transmission by alpha2-adrenoceptor antagonists counteracts deafferentation-induced neuronal death and cell proliferation in the adult mouse olfactory bulb. Exp Neurol. 2005 Aug;194(2):444-56. | |||||
REF 67 | Studies of midaglizole (DG-5128). A new type of oral hypoglycemic drug in healthy subjects. Diabetes. 1987 Feb;36(2):216-20. | |||||
REF 68 | Design and synthesis of novel dihydropyridine alpha-1a antagonists. Bioorg Med Chem Lett. 1999 Oct 4;9(19):2843-8. | |||||
REF 69 | alpha 2 adrenoceptors: classification, localization, mechanisms, and targets for drugs. J Med Chem. 1982 Dec;25(12):1389-401. | |||||
REF 70 | Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. | |||||
REF 71 | 3,7-Disubstituted-1,2,3,4-tetrahydroisoquinolines display remarkable potency and selectivity as inhibitors of phenylethanolamine N-methyltransferas... J Med Chem. 1999 Jun 3;42(11):1982-90. | |||||
REF 72 | Synthesis and evaluation of 2-(arylamino)imidazoles as alpha 2-adrenergic agonists. J Med Chem. 1997 Jan 3;40(1):18-23. | |||||
REF 73 | Synthesis and structure-activity relationships of N-propyl-N-(4-pyridinyl)-1H-indol-1-amine (besipirdine) and related analogs as potential therapeu... J Med Chem. 1996 Jan 19;39(2):570-81. | |||||
REF 74 | Effect of ring size or an additional heteroatom on the potency and selectivity of bicyclic benzylamine-type inhibitors of phenylethanolamine N-meth... J Med Chem. 1996 Aug 30;39(18):3539-46. | |||||
REF 75 | N-(Iodopropenyl)-octahydrobenzo[f]- and -[g]quinolines: synthesis and adrenergic and dopaminergic activity studies. J Med Chem. 1998 Oct 8;41(21):4165-70. | |||||
REF 76 | Examination of the role of the acidic hydrogen in imparting selectivity of 7-(aminosulfonyl)-1,2,3,4-tetrahydroisoquinoline (SK&F 29661) toward inh... J Med Chem. 1997 Dec 5;40(25):3997-4005. | |||||
REF 77 | Pyrazino[1,2-a]indoles as novel high-affinity and selective imidazoline I(2) receptor ligands. Bioorg Med Chem Lett. 2004 Feb 23;14(4):1003-5. | |||||
REF 78 | Comparison of the binding of 3-fluoromethyl-7-sulfonyl-1,2,3,4-tetrahydroisoquinolines with their isosteric sulfonamides to the active site of phen... J Med Chem. 2006 Sep 7;49(18):5424-33. | |||||
REF 79 | 1-((S)-2-aminopropyl)-1H-indazol-6-ol: a potent peripherally acting 5-HT2 receptor agonist with ocular hypotensive activity. J Med Chem. 2006 Jan 12;49(1):318-28. | |||||
REF 80 | Probes for imidazoline binding sites: synthesis and evaluation of a selective, irreversible I2 ligand. Bioorg Med Chem Lett. 2000 Mar 20;10(6):605-7. | |||||
REF 81 | 3-hydroxymethyl-7-(N-substituted aminosulfonyl)-1,2,3,4-tetrahydroisoquinoline inhibitors of phenylethanolamine N-methyltransferase that display re... J Med Chem. 2005 Jan 13;48(1):134-40. | |||||
REF 82 | Medetomidine analogs as alpha 2-adrenergic ligands. 3. Synthesis and biological evaluation of a new series of medetomidine analogs and their potent... J Med Chem. 1997 Sep 12;40(19):3014-24. | |||||
REF 83 | Phe-308 and Phe-312 in transmembrane domain 7 are major sites of alpha 1-adrenergic receptor antagonist binding. Imidazoline agonists bind like ant... J Biol Chem. 2001 Jul 6;276(27):25366-71. | |||||
REF 84 | Selectivity of agonists for cloned alpha 1-adrenergic receptor subtypes. Mol Pharmacol. 1994 Nov;46(5):929-36. | |||||
REF 85 | Binding of an imidazopyridoindole at imidazoline I2 receptors. Bioorg Med Chem Lett. 2004 Jan 19;14(2):527-9. | |||||
REF 86 | A-61603, a potent alpha 1-adrenergic receptor agonist, selective for the alpha 1A receptor subtype. J Pharmacol Exp Ther. 1995 Jul;274(1):97-103. | |||||
REF 87 | Discovery of new tetracyclic tetrahydrofuran derivatives as potential broad-spectrum psychotropic agents. J Med Chem. 2005 Mar 24;48(6):1709-12. | |||||
REF 88 | Selective irreversible binding of chloroethylclonidine at alpha 1- and alpha 2-adrenoceptor subtypes. Mol Pharmacol. 1993 Dec;44(6):1165-70. | |||||
REF 89 | The histamine H3 receptor: from gene cloning to H3 receptor drugs. Nat Rev Drug Discov. 2005 Feb;4(2):107-20. | |||||
REF 90 | The alkaloid conessine and analogues as potent histamine H3 receptor antagonists. J Med Chem. 2008 Sep 11;51(17):5423-30. | |||||
REF 91 | Discriminative stimulus properties of ethoxy idazoxan. J Psychopharmacol. 1995 Jan;9(3):228-33. | |||||
REF 92 | Structure-activity relationship of quinoline derivatives as potent and selective alpha(2C)-adrenoceptor antagonists. J Med Chem. 2006 Oct 19;49(21):6351-63. | |||||
REF 93 | Pharmacological characterization and CNS effects of a novel highly selective alpha2C-adrenoceptor antagonist JP-1302. Br J Pharmacol. 2007 Feb;150(4):391-402. | |||||
REF 94 | 4-Amino-6-chloro-2-piperazinopyrimidines with selective affinity for alpha 2-adrenoceptors. J Med Chem. 1986 Aug;29(8):1394-8. | |||||
REF 95 | Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther. 2002 Nov;303(2):791-804. | |||||
REF 96 | Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-a... Bioorg Med Chem. 2007 Jun 1;15(11):3649-60. | |||||
REF 97 | Affinity of serotonin receptor antagonists and agonists to recombinant and native alpha1-adrenoceptor subtypes. Jpn J Pharmacol. 2001 Jun;86(2):189-95. | |||||
REF 98 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 27). | |||||
REF 99 | Ligand efficacy and potency at recombinant alpha2 adrenergic receptors: agonist-mediated [35S]GTPgammaS binding. Biochem Pharmacol. 1998 Apr 1;55(7):1035-43. | |||||
REF 100 | Cloning and pharmacological characterization of human alpha-1 adrenergic receptors: sequence corrections and direct comparison with other species homologues. J Pharmacol Exp Ther. 1995 Jan;272(1):134-42. | |||||
REF 101 | KMD-3213, a novel, potent, alpha 1a-adrenoceptor-selective antagonist: characterization using recombinant human alpha 1-adrenoceptors and native tissues. Mol Pharmacol. 1995 Aug;48(2):250-8. | |||||
REF 102 | The novel alpha-2 adrenergic radioligand [3H]-MK912 is alpha-2C selective among human alpha-2A, alpha-2B and alpha-2C adrenoceptors. J Pharmacol Exp Ther. 1994 Dec;271(3):1558-65. | |||||
REF 103 | Pharmacological characteristics of alpha 2-adrenergic receptors: comparison of pharmacologically defined subtypes with subtypes identified by molecular cloning. Mol Pharmacol. 1992 Jul;42(1):1-5. | |||||
REF 104 | Further characterization of human alpha 2-adrenoceptor subtypes: [3H]RX821002 binding and definition of additional selective drugs. Eur J Pharmacol. 1994 Jan 24;252(1):43-9. | |||||
REF 105 | Alpha-adrenoreceptor reagents. 4. Resolution of some potent selective prejunctional alpha 2-adrenoreceptor antagonists. J Med Chem. 1986 Oct;29(10):2000-3. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.