Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T51487
|
||||
Former ID |
TTDS00403
|
||||
Target Name |
Gamma-aminobutyric acid receptor subunit alpha-1
|
||||
Gene Name |
GABRA1
|
||||
Synonyms |
GABA(A) receptor subunit alpha-1; GABRA1
|
||||
Target Type |
Successful
|
||||
Disease | Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | ||||
Anesthesia [ICD9: 338; ICD10: R20.0] | |||||
Depression [ICD9: 311; ICD10: F30-F39] | |||||
Epilepsy; Anxiety disorder [ICD9: 300, 345; ICD10: F40-F42, G40] | |||||
Epilepsy [ICD10: G40] | |||||
Epileptic seizures [ICD9: 345.9, 780.3; ICD10: G40, P90, R56] | |||||
Headache; Anxiety disorder [ICD9:339, 784.0, 300, 311; ICD10: G43-G44, R51, F32, F40-F42] | |||||
Insomnia [ICD9: 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F51.0, G47.0] | |||||
Insomnia; Anxiety disorder [ICD9:307.41, 307.42, 327.0, 780.51, 780.52, 300, 311; ICD10: F51.0, G47.0, F32, F40-F42] | |||||
Intractable insomnia [ICD10: G47] | |||||
Intractable chronic pain; Cystitis [ICD9:338, 780; ICD10: R52, G89, N30] | |||||
Insomnia; Epilepsy [ICD9:307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F51.0, G47.0, G40] | |||||
Inflammation [ICD10: E08-E13, E10.2, E11, E11.2, E13.2, I73.9, I80-I82, N00-N29, G89] | |||||
Muscle spasm [ICD10: M62.838] | |||||
Premenstrual syndrome [ICD10: N94.3] | |||||
Respiratory distress syndrome [ICD9: 518.5, 518.82; ICD10: J80] | |||||
Sleep maintenance insomnia [ICD9: 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F51.0, G47.0] | |||||
Function |
Component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the vertebrate brain. Functions also as histamine receptor and mediates cellular responses to histamine. Functions as receptor for diazepines and various anesthetics, such as pentobarbital; these are bound at a separate allosteric effector binding site. Functions as ligand- gated chloride channel (By similarity).
|
||||
BioChemical Class |
Ligand-gated ion channel
|
||||
Target Validation |
T51487
|
||||
UniProt ID | |||||
Sequence |
MRKSPGLSDCLWAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPG
LGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASK IWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHAC PLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVM TTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDP LIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKID RLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ |
||||
Drugs and Mode of Action | |||||
Drug(s) | Amobarbital | Drug Info | Approved | Insomnia; Anxiety disorder | [550722], [551871] |
Barbital | Drug Info | Approved | Insomnia | [536555] | |
Barbituric acid | Drug Info | Approved | Depression | [536555] | |
Butabarbital | Drug Info | Approved | Insomnia | [538357], [542144] | |
Butalbital | Drug Info | Approved | Headache; Anxiety disorder | [538316], [542145], [551871] | |
Butethal | Drug Info | Approved | Insomnia | [550763] | |
Clobazam | Drug Info | Approved | Epilepsy; Anxiety disorder | [542156], [550702] | |
Ethanol | Drug Info | Approved | Intractable chronic pain; Cystitis | [537292], [539450], [551871] | |
Ethchlorvynol | Drug Info | Approved | Insomnia | [538355], [542191] | |
Hexobarbital | Drug Info | Approved | Anesthesia | [550698] | |
Meprobamate | Drug Info | Approved | Anxiety disorder | [538193], [542240] | |
Methohexital | Drug Info | Approved | Anesthesia | [538449], [542249] | |
Methoxyflurane | Drug Info | Approved | Anesthesia | [542250], [550732] | |
Methylphenobarbital | Drug Info | Approved | Anxiety disorder | [550692] | |
Methyprylon | Drug Info | Approved | Insomnia | [536255], [542254] | |
Nitrazepam | Drug Info | Approved | Insomnia; Epilepsy | [550758], [551871] | |
Pentobarbital | Drug Info | Approved | Insomnia; Anxiety disorder | [538348], [540880], [551871] | |
Picrotoxin | Drug Info | Approved | Respiratory distress syndrome | [540650], [550699] | |
Primidone | Drug Info | Approved | Epilepsy | [538190], [540777] | |
Secobarbital | Drug Info | Approved | Intractable insomnia | [551871] | |
THIOCOLCHICOSIDE | Drug Info | Approved | Muscle spasm | [551871] | |
Zaleplon | Drug Info | Approved | Insomnia | [467682], [538325] | |
Zolpidem | Drug Info | Approved | Insomnia | [467685], [551871] | |
ZK-93423 | Drug Info | Phase 3 | Epileptic seizures | [467683], [533661] | |
ALLOPREGNANOLONE | Drug Info | Phase 2 | Discovery agent | [467451], [524035] | |
Zolpidem | Drug Info | Phase 1 | Sleep maintenance insomnia | [531325] | |
ELTANOLONE | Drug Info | Discontinued in Phase 3 | Premenstrual syndrome | [546011] | |
U-78875 | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [544810] | |
CGS-9896 | Drug Info | Terminated | Discovery agent | [544687] | |
Divaplon | Drug Info | Terminated | Discovery agent | [544692] | |
Inhibitor | (2-Amino-4,5-dihydro-thiazol-4-yl)-acetic acid | Drug Info | [551228] | ||
(2E,4S)-4-ammoniopent-2-enoate | Drug Info | [533514] | |||
(4R)-4-ammoniopentanoate | Drug Info | [533514] | |||
(4S)-4-ammoniopentanoate | Drug Info | [533514] | |||
(6-Benzylamino-9H-beta-carbolin-3-yl)-methanol | Drug Info | [533414] | |||
(9-Benzyl-9H-purin-6-yl)-cyclopropyl-amine | Drug Info | [533033] | |||
(9H-beta-Carbolin-3-yl)-carbamic acid ethyl ester | Drug Info | [533400] | |||
(9H-beta-Carbolin-3-yl)-ethyl-amine | Drug Info | [533400] | |||
(9H-beta-Carbolin-3-yl)-methanol | Drug Info | [533414] | |||
(beta-CCE)9H-beta-Carboline-3-carboxylic acid | Drug Info | [526738] | |||
1,1-Dimethyl-5-oxa-spiro[2.4]heptan-4-one | Drug Info | [533975] | |||
1,3-Diphenyl-1H-chromeno[4,3-c]pyrazol-4-one | Drug Info | [533354] | |||
1-(4-chlorophenyl)-4-phenyl-1H-imidazole | Drug Info | [528080] | |||
1-(9H-beta-Carbolin-3-yl)-butan-1-one | Drug Info | [526755] | |||
1-(9H-beta-Carbolin-3-yl)-ethanone | Drug Info | [533414] | |||
1-Methyl-5-oxa-spiro[2.4]heptan-4-one | Drug Info | [533975] | |||
2-(1H-Indol-3-yl)-2-oxo-N-phenethyl-acetamide | Drug Info | [526738] | |||
2-(3-Bromo-phenyl)-6-nitro-chromen-4-one | Drug Info | [551323] | |||
2-(3-Bromo-phenyl)-chromen-4-one | Drug Info | [551323] | |||
2-(3-Chloro-phenyl)-chromen-4-one | Drug Info | [551323] | |||
2-(4-Chloro-phenyl)-3H-imidazo[4,5-c]quinoline | Drug Info | [534155] | |||
2-(4-chlorophenyl)-5-phenyl-4-isoxazolin-3-one | Drug Info | [528080] | |||
2-(9-Benzyl-9H-purin-6-ylamino)-ethanol | Drug Info | [533033] | |||
2-Furan-2-yl-6H-pyrazolo[1,5-c]quinazolin-5-one | Drug Info | [534157] | |||
2-Isoxazol-3-yl-3H-imidazo[4,5-c]quinoline | Drug Info | [534155] | |||
2-Isoxazol-5-yl-3H-imidazo[4,5-c]quinoline | Drug Info | [534155] | |||
2-Oxa-spiro[4.4]nonan-1-one | Drug Info | [533975] | |||
2-p-Tolyl-6H-pyrazolo[1,5-c]quinazolin-5-one | Drug Info | [534157] | |||
2-Phenyl-3H-imidazo[4,5-c]quinoline | Drug Info | [534155] | |||
2-Phenyl-5,6-dihydro-pyrazolo[1,5-c]quinazoline | Drug Info | [534157] | |||
2-Phenyl-6H-pyrazolo[1,5-c]quinazolin-5-one | Drug Info | [534157] | |||
2-Pyridin-2-yl-6H-pyrazolo[1,5-c]quinazolin-5-one | Drug Info | [534157] | |||
2-Thiophen-2-yl-3H-imidazo[4,5-c]quinoline | Drug Info | [534155] | |||
3,3-Diethyl-dihydro-furan-2-one | Drug Info | [533975] | |||
3,3-Diisopropyl-dihydro-furan-2-one | Drug Info | [533975] | |||
3-(2,2-Dimethyl-propoxy)-9H-beta-carboline | Drug Info | [526755] | |||
3-(3-Methyl-butoxy)-9H-beta-carboline | Drug Info | [526755] | |||
3-(benzyloxy)-9H-pyrido[3,4-b]indole | Drug Info | [531188] | |||
3-(hexa-1,3-dienyloxy)-9H-pyrido[3,4-b]indole | Drug Info | [531188] | |||
3-(isopentyloxy)-9H-pyrido[3,4-b]indole | Drug Info | [531188] | |||
3-amino-3-demethoxythiocolchicine | Drug Info | [528408] | |||
3-Butoxy-9H-beta-carboline | Drug Info | [526755] | |||
3-butoxy-9H-pyrido[3,4-b]indole | Drug Info | [531188] | |||
3-butoxycarbonyl-4-quinolone | Drug Info | [528134] | |||
3-butoxycarbonyl-6-ethyl-4-quinolone | Drug Info | [528134] | |||
3-butylaminocarbonyl-6-ethyl-4-quinolone | Drug Info | [528134] | |||
3-carboxy-6-ethyl-4-quinolone | Drug Info | [528134] | |||
3-Chloro-9H-beta-carboline | Drug Info | [533363] | |||
3-cyclopentoxycarbonyl-6-ethyl-4-quinolone | Drug Info | [528134] | |||
3-demethoxy-3-D-lyxopyranosylaminothiocolchicine | Drug Info | [528408] | |||
3-demethoxy-3-D-mannopyranosylaminothiocolchicine | Drug Info | [528408] | |||
3-demethoxy-3-D-xylopyranosylaminothiocolchicine | Drug Info | [528408] | |||
3-demethoxy-3-L-fucopyranosylaminothiocolchicine | Drug Info | [528408] | |||
3-demethoxy-3D-glucopyranosylaminothiocolchicine | Drug Info | [528408] | |||
3-Ethoxy-9H-beta-carboline | Drug Info | [533363] | |||
3-ethoxy-9H-pyrido[3,4-b]indole | Drug Info | [531188] | |||
3-ethoxycarbonyl-4-quinolone | Drug Info | [528134] | |||
3-ethoxycarbonyl-6-ethyl-2-methyl-4-quinolone | Drug Info | [528134] | |||
3-ethoxycarbonyl-6-propyl-4-quinolone | Drug Info | [528134] | |||
3-Ethyl-3-isopropyl-dihydro-furan-2-one | Drug Info | [533975] | |||
3-Ethyl-3-methyl-dihydro-furan-2-one | Drug Info | [533975] | |||
3-Isobutoxy-9H-beta-carboline | Drug Info | [526755] | |||
3-isobutoxy-9H-pyrido[3,4-b]indole | Drug Info | [531188] | |||
3-Isopropoxy-9H-beta-carboline | Drug Info | [526755] | |||
3-Isopropyl-3-methyl-dihydro-furan-2-one | Drug Info | [533975] | |||
3-Isothiocyanato-9H-beta-carboline | Drug Info | [531518] | |||
3-Methoxy-9H-beta-carboline | Drug Info | [533363] | |||
3-Methoxycarbonyl-2-methyl-9H-beta-carbolin-2-ium | Drug Info | [551248] | |||
3-Methyl-1-phenyl-1H-chromeno[4,3-c]pyrazol-4-one | Drug Info | [533354] | |||
3-Methyl-2-phenyl-2H-chromeno[4,3-c]pyrazol-4-one | Drug Info | [533354] | |||
3-Methyl-9H-beta-carboline | Drug Info | [533745] | |||
3-Nitro-9H-beta-carboline | Drug Info | [533363] | |||
3-Propoxy-9H-beta-carboline | Drug Info | [533363] | |||
3-propoxy-9H-pyrido[3,4-b]indole | Drug Info | [531188] | |||
3-sec-Butoxy-9H-beta-carboline | Drug Info | [526755] | |||
3-tert-Butyl-3-ethyl-dihydro-furan-2-one | Drug Info | [533975] | |||
4-(2-aminoethyl)-1,2,5-oxadiazol-3-ol | Drug Info | [528295] | |||
4-(4-chlorophenyl)-1-pyrid-2-yl-pyrazole | Drug Info | [528080] | |||
4-(biphenyl-3-yl)-5-(piperidin-4-yl)isoxazol-3-ol | Drug Info | [530818] | |||
4-benzyl-5-(4-piperidyl)isothiazol-3-ol | Drug Info | [528034] | |||
4-Benzyl-5-piperidin-4-yl-isoxazol-3-ol | Drug Info | [527382] | |||
4-Methoxymethyl-3,6-dipropoxy-9H-beta-carboline | Drug Info | [534660] | |||
4-Methyl-5-(4-piperidyl)isothiazol-3-ol | Drug Info | [528034] | |||
4-Naphthalen-1-yl-5-piperidin-4-yl-isoxazol-3-ol | Drug Info | [527382] | |||
4-Naphthalen-2-yl-5-piperidin-4-yl-isoxazol-3-ol | Drug Info | [527382] | |||
4-Phenyl-5-piperidin-4-yl-isoxazol-3-ol | Drug Info | [527382] | |||
5-(4-piperidyl)-4-propylisothiazol-3-ol | Drug Info | [528034] | |||
5-(piperidin-4-yl)isothiazol-3-ol | Drug Info | [528034] | |||
5-(piperidin-4-yl)isoxazol-3-ol | Drug Info | [527382] | |||
5-[(1R)-1-ammonioethyl]isoxazol-3-olate | Drug Info | [533514] | |||
5-[(1S)-1-ammonioethyl]isoxazol-3-olate | Drug Info | [533514] | |||
6,6-Dimethyl-2-oxa-spiro[4.4]nonan-1-one | Drug Info | [533975] | |||
6,9-Dimethyl-2-oxa-spiro[4.4]nonan-1-one | Drug Info | [533975] | |||
6-benzyl-3-ethoxycarbonyl-4-quinolone | Drug Info | [528134] | |||
6-benzyl-3-propoxycarbonyl-4-quinolone | Drug Info | [528134] | |||
6-benzyl-3-propylaminocarbonyl-4-quinolone | Drug Info | [528134] | |||
6-Bromo-2-(2-nitro-phenyl)-chromen-4-one | Drug Info | [551336] | |||
6-Bromo-2-(3-bromo-phenyl)-chromen-4-one | Drug Info | [551323] | |||
6-Bromo-2-(3-nitro-phenyl)-chromen-4-one | Drug Info | [551336] | |||
6-Bromo-2-(4-nitro-phenyl)-chromen-4-one | Drug Info | [551336] | |||
6-Bromo-2-phenyl-chromen-4-one | Drug Info | [551323] | |||
6-bromo-3-ethoxycarbonyl-2-methyl-4-quinolone | Drug Info | [528134] | |||
6-bromo-3-ethoxycarbonyl-4-quinolone | Drug Info | [528134] | |||
6-Chloro-2-(3-nitro-phenyl)-chromen-4-one | Drug Info | [551323] | |||
6-Chloro-2-phenyl-chromen-4-one | Drug Info | [551323] | |||
6-ethyl-3-(2-ethylbutoxycarbonyl)-4-quinolone | Drug Info | [528134] | |||
6-ethyl-3-(2-methylbutoxycarbonyl)-4-quinolone | Drug Info | [528134] | |||
6-ethyl-3-(3-methylbutoxycarbonyl)-4-quinolone | Drug Info | [528134] | |||
6-ethyl-3-(3-pentoxycarbonyl)-4-quinolone | Drug Info | [528134] | |||
6-ethyl-3-i-propoxycarbonyl-4-quinolone | Drug Info | [528134] | |||
6-ethyl-3-pentoxycarbonyl-4-quinolone | Drug Info | [528134] | |||
6-ethyl-3-propoxycarbonyl-4-quinolone | Drug Info | [528134] | |||
6-ethyl-3-propylaminocarbonyl-4-quinolone | Drug Info | [528134] | |||
6-Fluoro-2-(3-nitro-phenyl)-chromen-4-one | Drug Info | [551323] | |||
6-Methyl-2-oxa-spiro[4.4]nonan-1-one | Drug Info | [533975] | |||
6-Nitro-2-(3-nitro-phenyl)-chromen-4-one | Drug Info | [551290] | |||
6-Nitro-2-(4-nitro-phenyl)-chromen-4-one | Drug Info | [551290] | |||
6-Nitro-2-phenyl-chromen-4-one | Drug Info | [551323] | |||
7,12-Dihydro-5,7,12-triaza-indeno[1,2-a]fluorene | Drug Info | [533412] | |||
7,12-Dihydro-7,12-diaza-indeno[1,2-a]fluorene | Drug Info | [533363] | |||
9H-beta-Carbolin-3-ol | Drug Info | [533363] | |||
9H-beta-Carbolin-6-ylamine | Drug Info | [533414] | |||
9H-beta-Carboline-3-carboxylic acid butyl ester | Drug Info | [533546] | |||
9H-beta-Carboline-3-carboxylic acid ethyl ester | Drug Info | [533546] | |||
9H-beta-Carboline-3-carboxylic acid propyl ester | Drug Info | [533546] | |||
ALLOPREGNANOLONE | Drug Info | [527511] | |||
AMENTOFLAVONE | Drug Info | [526653] | |||
Barbituric acid derivative | Drug Info | [551407] | |||
Benzyl-(9H-beta-carbolin-6-yl)-amine | Drug Info | [533363] | |||
Beta-Carboline-3-carboxylic acid t-butyl ester | Drug Info | [531188] | |||
BETA-CCM | Drug Info | [533763] | |||
CGP-27492 | Drug Info | [533678] | |||
CGS-13767 | Drug Info | [529466] | |||
CGS-8216 | Drug Info | [529466] | |||
CGS-9895 | Drug Info | [533348] | |||
CGS-9896 | Drug Info | [528080] | |||
CI-218872 | Drug Info | [533745] | |||
Divaplon | Drug Info | [533379] | |||
ELTANOLONE | Drug Info | [527511] | |||
Ethyl 6-iodo-9H-pyrido[3,4-b]indole-3-carboxylate | Drug Info | [531188] | |||
Ethyl 9H-pyrido[3,4-b]indole-3-carboxylate | Drug Info | [531188] | |||
GABAZINE | Drug Info | [528034] | |||
GAMMA-AMINO-BUTANOIC ACID | Drug Info | [528408] | |||
GNF-PF-3645 | Drug Info | [528134] | |||
GNF-PF-4421 | Drug Info | [528134] | |||
Isoquinoline-3-carboxylic acid methyl ester | Drug Info | [533363] | |||
L-655708 | Drug Info | [527005] | |||
N-(9H-beta-Carbolin-3-yl)-acetamide | Drug Info | [533400] | |||
N-(9H-beta-Carbolin-3-yl)-formamide | Drug Info | [533400] | |||
N-(p-methylbenzyl)-5-nitroindol-3-ylglyoxylamide | Drug Info | [528709] | |||
N-Benzyl-2-(1H-indol-3-yl)-2-oxo-acetamide | Drug Info | [528709] | |||
N-benzyl-2-(5-nitro-1H-indol-3-yl)-2-oxoacetamide | Drug Info | [528709] | |||
N-butyl-2-(1H-indol-3-yl)-2-oxoacetamide | Drug Info | [528709] | |||
N-butyl-2-(5-nitro-1H-indol-3-yl)-2-oxoacetamide | Drug Info | [528709] | |||
N-Indan-1-yl-2-(1H-indol-3-yl)-2-oxo-acetamide | Drug Info | [526094] | |||
NORHARMANE | Drug Info | [533363] | |||
NSC-19028 | Drug Info | [551323] | |||
NSC-73613 | Drug Info | [551323] | |||
NSC-93394 | Drug Info | [551323] | |||
Pyrrolidin-3-yl-acetic acid | Drug Info | [533396] | |||
Ridine-5-carboxylic acid ethyl ester | Drug Info | [533164] | |||
RIPAZEPAM | Drug Info | [533397] | |||
RO-054520 | Drug Info | [533368] | |||
RO-145974 | Drug Info | [534008] | |||
RO-145975 | Drug Info | [534008] | |||
RO-147437 | Drug Info | [534008] | |||
Ro-151310 | Drug Info | [534008] | |||
Ro-154513 | Drug Info | [534008] | |||
RO-194603 | Drug Info | [534008] | |||
Ro-4938581 | Drug Info | [530391] | |||
RWJ-16979 | Drug Info | [533762] | |||
RY-066 | Drug Info | [534718] | |||
Sec-butyl 9H-pyrido[3,4-b]indole-3-carboxylate | Drug Info | [531188] | |||
THIOCOLCHICOSIDE | Drug Info | [528408] | |||
U-78875 | Drug Info | [525465] | |||
U-89267 | Drug Info | [533912] | |||
ZK-93423 | Drug Info | [530319] | |||
Antagonist | Amobarbital | Drug Info | [536555], [537688] | ||
Barbital | Drug Info | [536555], [537688] | |||
Barbituric acid | Drug Info | [536555], [537688] | |||
Butabarbital | Drug Info | [535022], [536555], [537688] | |||
Butalbital | Drug Info | [536555] | |||
Butethal | Drug Info | [536555] | |||
Clobazam | Drug Info | [536555] | |||
Ethanol | Drug Info | [536555] | |||
Ethchlorvynol | Drug Info | [536555] | |||
Hexobarbital | Drug Info | [536555], [537688] | |||
Meprobamate | Drug Info | [536555] | |||
Methohexital | Drug Info | [536555] | |||
Methoxyflurane | Drug Info | [536555] | |||
Methylphenobarbital | Drug Info | [536555], [537688] | |||
Methyprylon | Drug Info | [536555] | |||
Nitrazepam | Drug Info | [536555] | |||
Pentobarbital | Drug Info | [536555], [537688] | |||
Picrotoxin | Drug Info | [536555] | |||
Primidone | Drug Info | [536555] | |||
Secobarbital | Drug Info | [536555], [537688] | |||
Modulator | Zaleplon | Drug Info | [556264] | ||
Zolpidem | Drug Info | ||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
Retrograde endocannabinoid signaling | |||||
GABAergic synapse | |||||
Morphine addiction | |||||
Nicotine addiction | |||||
Reactome | Ligand-gated ion channel transport | ||||
GABA A receptor activation | |||||
WikiPathways | SIDS Susceptibility Pathways | ||||
Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | |||||
Iron uptake and transport | |||||
References | |||||
Ref 467451 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4108). | ||||
Ref 467682 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4345). | ||||
Ref 467683 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4346). | ||||
Ref 467685 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4348). | ||||
Ref 524035 | ClinicalTrials.gov (NCT01673828) Allopregnanolone for the Treatment of Traumatic Brain Injury. U.S. National Institutes of Health. | ||||
Ref 531325 | Improved insomnia symptoms and sleep-related next-day functioning in patients with comorbid major depressive disorder and insomnia following concomitant zolpidem extended-release 12.5 mg and escitalopram treatment: a randomized controlled trial. J Clin Psychiatry. 2011 Jul;72(7):914-28. | ||||
Ref 533661 | Abecarnil enhances GABA-induced currents in acutely isolated cerebellar Purkinje cells. Neuropharmacology. 1995 Feb;34(2):157-63. | ||||
Ref 536255 | Nonlinear elimination of methyprylon (noludar) in an overdosed patient: correlation of clinical effects with plasma concentration. J Pharm Sci. 1991 Aug;80(8):768-71. | ||||
Ref 536555 | DrugBank: a knowledgebase for drugs, drug actions and drug targets. Nucleic Acids Res. 2008 Jan;36(Database issue):D901-6. Epub 2007 Nov 29. | ||||
Ref 537292 | Preclinical evaluation of riluzole: assessments of ethanol self-administration and ethanol withdrawal symptoms. Alcohol Clin Exp Res. 2009 Aug;33(8):1460-8. | ||||
Ref 538190 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040586. | ||||
Ref 538193 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040797. | ||||
Ref 538316 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 076528. | ||||
Ref 538325 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 077237. | ||||
Ref 538348 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 083270. | ||||
Ref 538355 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 084463. | ||||
Ref 538357 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 085550. | ||||
Ref 538449 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011559. | ||||
Ref 539450 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2299). | ||||
Ref 540650 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4051). | ||||
Ref 540777 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5338). | ||||
Ref 540880 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5480). | ||||
Ref 542144 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7137). | ||||
Ref 542145 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7138). | ||||
Ref 542156 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7149). | ||||
Ref 542191 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7180). | ||||
Ref 542240 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7225). | ||||
Ref 542249 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7233). | ||||
Ref 542250 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7234). | ||||
Ref 542254 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7238). | ||||
Ref 544687 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000585) | ||||
Ref 544692 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000631) | ||||
Ref 544810 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001194) | ||||
Ref 525465 | J Med Chem. 1999 Apr 8;42(7):1123-44.Piperazine imidazo[1,5-a]quinoxaline ureas as high-affinity GABAA ligands of dual functionality. | ||||
Ref 526094 | J Med Chem. 2001 Jul 5;44(14):2286-97.Novel N-(arylalkyl)indol-3-ylglyoxylylamides targeted as ligands of the benzodiazepine receptor: synthesis, biological evaluation, and molecular modeling analysis of the structure-activity relationships. | ||||
Ref 526653 | Bioorg Med Chem Lett. 2003 Jul 21;13(14):2281-4.Semisynthetic preparation of amentoflavone: A negative modulator at GABA(A) receptors. | ||||
Ref 526738 | J Med Chem. 1992 Jun 12;35(12):2214-20.Benzodiazepine receptor affinity and interaction of some N-(indol-3-ylglyoxylyl)amine derivatives. | ||||
Ref 526755 | J Med Chem. 1992 Oct 30;35(22):4001-10.Predictive binding of beta-carboline inverse agonists and antagonists via the CoMFA/GOLPE approach. | ||||
Ref 527005 | J Med Chem. 2004 Mar 25;47(7):1807-22.3-phenyl-6-(2-pyridyl)methyloxy-1,2,4-triazolo[3,4-a]phthalazines and analogues: high-affinity gamma-aminobutyric acid-A benzodiazepine receptor ligands with alpha 2, alpha 3, and alpha 5-subtype binding selectivity over alpha 1. | ||||
Ref 527382 | J Med Chem. 2005 Jan 27;48(2):427-39.Potent 4-aryl- or 4-arylalkyl-substituted 3-isoxazolol GABA(A) antagonists: synthesis, pharmacology, and molecular modeling. | ||||
Ref 527511 | J Med Chem. 2005 Apr 21;48(8):3051-9.Neurosteroid analogues. 10. The effect of methyl group substitution at the C-6 and C-7 positions on the GABA modulatory and anesthetic actions of (3alpha,5alpha)-and (3alpha,5beta)-3-hydroxypregnan-20-one. | ||||
Ref 528034 | J Med Chem. 2006 Feb 23;49(4):1388-96.Potent 4-arylalkyl-substituted 3-isothiazolol GABA(A) competitive/noncompetitive antagonists: synthesis and pharmacology. | ||||
Ref 528080 | J Med Chem. 2006 Mar 23;49(6):1855-66.Synthesis, pharmacology, and structure-activity relationships of novel imidazolones and pyrrolones as modulators of GABAA receptors. | ||||
Ref 528134 | J Med Chem. 2006 Apr 20;49(8):2526-33.4-quinolone derivatives: high-affinity ligands at the benzodiazepine site of brain GABA A receptors. synthesis, pharmacology, and pharmacophore modeling. | ||||
Ref 528295 | J Med Chem. 2006 Jul 13;49(14):4442-6.Hydroxy-1,2,5-oxadiazolyl moiety as bioisoster of the carboxy function. Synthesis, ionization constants, and pharmacological characterization of gamma-aminobutyric acid (GABA) related compounds. | ||||
Ref 528408 | J Med Chem. 2006 Sep 7;49(18):5571-7.3-demethoxy-3-glycosylaminothiocolchicines: Synthesis of a new class of putative muscle relaxant compounds. | ||||
Ref 528709 | J Med Chem. 2007 Apr 5;50(7):1627-34. Epub 2007 Mar 3.Novel N-substituted indol-3-ylglyoxylamides probing the LDi and L1/L2 lipophilic regions of the benzodiazepine receptor site in search for subtype-selective ligands. | ||||
Ref 529466 | J Med Chem. 1991 Jan;34(1):281-90.Synthesis and benzodiazepine binding activity of a series of novel [1,2,4]triazolo[1,5-c]quinazolin-5(6H)-ones. | ||||
Ref 530319 | J Med Chem. 1990 Mar;33(3):1062-9.Structural requirements for agonist actions at the benzodiazepine receptor: studies with analogues of 6-(benzyloxy)-4-(methoxymethyl)-beta-carboline-3-carboxylic acid ethyl ester. | ||||
Ref 530391 | Bioorg Med Chem Lett. 2009 Oct 15;19(20):5940-4. Epub 2009 Aug 15.The discovery and unique pharmacological profile of RO4938581 and RO4882224 as potent and selective GABAA alpha5 inverse agonists for the treatment of cognitive dysfunction. | ||||
Ref 530818 | J Med Chem. 2010 Apr 22;53(8):3417-21.Novel 4-(piperidin-4-yl)-1-hydroxypyrazoles as gamma-aminobutyric acid(A) receptor ligands: synthesis, pharmacology, and structure-activity relationships. | ||||
Ref 531188 | Bioorg Med Chem. 2010 Nov 1;18(21):7548-64. Epub 2010 Sep 29.Design, synthesis, and subtype selectivity of 3,6-disubstituted |A-carbolines at Bz/GABA(A)ergic receptors. SAR and studies directed toward agents for treatment of alcohol abuse. | ||||
Ref 531518 | J Med Chem. 1990 Sep;33(9):2343-57.Synthetic and computer-assisted analyses of the pharmacophore for the benzodiazepine receptor inverse agonist site. | ||||
Ref 533033 | J Med Chem. 1989 May;32(5):1020-4.Benzodiazepine receptor binding activity of 6,9-disubstituted purines. | ||||
Ref 533164 | J Med Chem. 1989 Dec;32(12):2561-73.Synthesis and structure-activity relationships of a series of anxioselective pyrazolopyridine ester and amide anxiolytic agents. | ||||
Ref 533348 | J Med Chem. 1987 Oct;30(10):1737-42.1,3-Diarylpyrazolo[4,5-c]- and -[5,4-c]quinolin-4-ones. 4. Synthesis and specific inhibition of benzodiazepine receptor binding. | ||||
Ref 533354 | J Med Chem. 1988 Jan;31(1):1-3.Synthesis, binding studies, and structure-activity relationships of 1-aryl-and 2-aryl[1]benzopyranopyrazol-4-ones, central benzodiazepine receptor ligands. | ||||
Ref 533363 | J Med Chem. 1988 Sep;31(9):1854-61.Synthesis of novel 3-substituted beta-carbolines as benzodiazepine receptor ligands: probing the benzodiazepine receptor pharmacophore. | ||||
Ref 533368 | J Med Chem. 1988 Dec;31(12):2235-46.Methods for drug discovery: development of potent, selective, orally effective cholecystokinin antagonists. | ||||
Ref 533379 | J Med Chem. 1988 Jun;31(6):1220-6.(Imidazo[1,2-a]pyrimidin-2-yl)phenylmethanones and related compounds as potential nonsedative anxiolytics. | ||||
Ref 533396 | J Med Chem. 1985 May;28(5):653-60.Orally active and potent inhibitors of gamma-aminobutyric acid uptake. | ||||
Ref 533397 | J Med Chem. 1985 May;28(5):683-5.Synthesis and interaction of 5-(substituted-phenyl)-3-methyl-6,7-dihydropyrazolo[4,3-e] [1,4]diazepin-8(7H)-ones with benzodiazepine receptors in rat cerebral cortex. | ||||
Ref 533400 | J Med Chem. 1985 Jun;28(6):824-8.3-Amino-beta-carboline derivatives and the benzodiazepine receptor. Synthesis of a selective antagonist of the sedative action of diazepam. | ||||
Ref 533412 | J Med Chem. 1987 Mar;30(3):456-8.Synthesis of 7,12-dihydropyrido[3,4-b:5,4-b']diindoles. A novel class of rigid, planar benzodiazepine receptor ligands. | ||||
Ref 533414 | J Med Chem. 1987 Apr;30(4):750-3.Synthesis of 6-substituted beta-carbolines that behave as benzodiazepine receptor antagonists or inverse agonists. | ||||
Ref 533514 | J Med Chem. 1981 Dec;24(12):1377-83.gamma-Aminobutyric acid agonists, antagonists, and uptake inhibitors. Design and therapeutic aspects. | ||||
Ref 533546 | J Med Chem. 1983 Apr;26(4):499-503.beta-Carbolines as benzodiazepine receptor ligands. 1. Synthesis and benzodiazepine receptor interaction of esters of beta-carboline-3-carboxylic acid. | ||||
Ref 533678 | J Med Chem. 1995 Aug 18;38(17):3297-312.Phosphinic acid analogues of GABA. 1. New potent and selective GABAB agonists. | ||||
Ref 533745 | J Med Chem. 1994 Dec 23;37(26):4576-80.Four amino acid exchanges convert a diazepam-insensitive, inverse agonist-preferring GABAA receptor into a diazepam-preferring GABAA receptor. | ||||
Ref 533762 | J Med Chem. 1995 Jan 6;38(1):16-20.Potential anxiolytic agents. Pyrido[1,2-a]benzimidazoles: a new structural class of ligands for the benzodiazepine binding site on GABA-A receptors. | ||||
Ref 533763 | J Med Chem. 1995 Jan 6;38(1):189-98.Synthetic routes to 4-amino-3-carboxy-beta-carboline derivatives: incidental formation of novel furo[3,4-c]-beta-carbolin-2-ones displaying high affinities for thebenzodiazepine receptor. | ||||
Ref 533912 | J Med Chem. 1994 Mar 18;37(6):758-68.Antagonist, partial agonist, and full agonist imidazo[1,5-a]quinoxaline amides and carbamates acting through the GABAA/benzodiazepine receptor. | ||||
Ref 533975 | J Med Chem. 1994 Jan 21;37(2):275-86.Alpha-spirocyclopentyl- and alpha-spirocyclopropyl-gamma-butyrolactones: conformationally constrained derivatives of anticonvulsant and convulsant alpha,alpha-disubstituted gamma-butyrolactones. | ||||
Ref 534008 | J Med Chem. 1993 Apr 16;36(8):1001-6.Synthesis and evaluation of imidazo[1,5-a][1,4]benzodiazepine esters with high affinities and selectivities at "diazepam-insensitive" benzodiazepine receptors. | ||||
Ref 534155 | J Med Chem. 1996 Jul 5;39(14):2844-51.Synthesis and structure--activity relationships of fused imidazopyridines: a new series of benzodiazepine receptor ligands. | ||||
Ref 534157 | J Med Chem. 1996 Jul 19;39(15):2915-21.Synthesis and binding activity of some pyrazolo[1,5-c]quinazolines as tools to verify an optional binding site of a benzodiazepine receptor ligand. | ||||
Ref 534660 | J Med Chem. 1998 Jul 2;41(14):2537-52.Synthesis and evaluation of analogues of the partial agonist 6-(propyloxy)-4-(methoxymethyl)-beta-carboline-3-carboxylic acid ethyl ester (6-PBC) and the full agonist 6-(benzyloxy)-4-(methoxymethyl)-beta-carboline-3-carboxylic acid ethyl ester (Zk 93423) at wild type and recombinant GABAA receptors. | ||||
Ref 534718 | J Med Chem. 1998 Oct 8;41(21):4130-42.Predictive models for GABAA/benzodiazepine receptor subtypes: studies of quantitative structure-activity relationships for imidazobenzodiazepines at five recombinant GABAA/benzodiazepine receptor subtypes [alphaxbeta3gamma2 (x = 1-3, 5, and 6)] via comparative molecular field analysis. | ||||
Ref 536555 | DrugBank: a knowledgebase for drugs, drug actions and drug targets. Nucleic Acids Res. 2008 Jan;36(Database issue):D901-6. Epub 2007 Nov 29. | ||||
Ref 537688 | Effect of barbiturates on polyphosphoinositide biosynthesis and protein kinase C activity in synaptosomes. Neuropharmacology. 1989 Dec;28(12):1317-23. | ||||
Ref 551228 | (?)-2-amino-2-thiazoline-4-ethanoic acid; a novel, specific GABAA receptor agonist. Bioorg. Med. Chem. Lett. 1(5):247-248 (1991). | ||||
Ref 551248 | N-2 methylated quaternary derivatives of beta-carboline-3-carboxylates inhibit acetylcholinesterase in vitroO, Bioorg. Med. Chem. Lett. 3(12):2831-2836 (1993). | ||||
Ref 551290 | 6,3'-Dinitroflavone, a novel high affinity ligand for the benzodiazepine receptor with potent anxiolytic properties, Bioorg. Med. Chem. Lett. 5(22):2717-2720 (1995). | ||||
Ref 551323 | Synthesis of halogenated/nitrated flavone derivatives and evaluation of their affinity for the central benzodiazepine receptor, Bioorg. Med. Chem. Lett. 7(15):2003-2008 (1997). | ||||
Ref 551336 | 6-Bromo-3??nitroflavone, a new high affinity benzodiazepine receptor agonist recognizes two populations of cerebral cortical binding sites, Bioorg. Med. Chem. Lett. 7(3):373-378 (1997). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.