Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T11072
(Former ID: TTDS00100)
|
|||||
Target Name |
5-HT 1D receptor (HTR1D)
|
|||||
Synonyms |
Serotonin receptor 1D; Serotonin 1D alpha receptor; HTRL; HTR1DA; 5HT1D; 5-hydroxytryptamine receptor 1D; 5-HT1D receptor; 5-HT1D; 5-HT-1D-alpha; 5-HT-1D
Click to Show/Hide
|
|||||
Gene Name |
HTR1D
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Migraine [ICD-11: 8A80] | |||||
2 | Pituitary gland disorder [ICD-11: 5A60-5A61] | |||||
Function |
Functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Regulates the release of 5-hydroxytryptamine in the brain, and thereby affects neural activity. May also play a role in regulating the release of other neurotransmitters. May play a role in vasoconstriction. G-protein coupled receptor for 5-hydroxytryptamine (serotonin).
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN EEFRQAFQKIVPFRKAS Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 7 Approved Drugs | + | ||||
1 | Almogran | Drug Info | Approved | Migraine | [2] | |
2 | Eletriptan | Drug Info | Approved | Migraine | [3], [4] | |
3 | Frovatriptan | Drug Info | Approved | Migraine | [4], [5] | |
4 | Metergolin | Drug Info | Approved | Hyperprolactinaemia | [6] | |
5 | Rizatriptan | Drug Info | Approved | Migraine | [7] | |
6 | Sumatriptan | Drug Info | Approved | Migraine | [4], [8] | |
7 | Zolmitriptan | Drug Info | Approved | Migraine | [9], [10] | |
Clinical Trial Drug(s) | [+] 4 Clinical Trial Drugs | + | ||||
1 | Neu-P11 | Drug Info | Phase 2 | Insomnia | [11] | |
2 | NXN-188 | Drug Info | Phase 2 | Migraine | [12] | |
3 | TGBA01AD | Drug Info | Phase 2 | Mood disorder | [13] | |
4 | Tonabersat | Drug Info | Phase 2 | Epilepsy | [14] | |
Discontinued Drug(s) | [+] 14 Discontinued Drugs | + | ||||
1 | Alniditan | Drug Info | Discontinued in Phase 3 | Migraine | [15], [16] | |
2 | Avitriptan | Drug Info | Discontinued in Phase 3 | Migraine | [17] | |
3 | BMS-181101 | Drug Info | Discontinued in Phase 2 | Mood disorder | [18], [19] | |
4 | CP-122288 | Drug Info | Discontinued in Phase 2 | Migraine | [20], [21] | |
5 | Elzasonan hydrochloride | Drug Info | Discontinued in Phase 2 | Mood disorder | [13] | |
6 | IS-159 | Drug Info | Discontinued in Phase 2 | Migraine | [22] | |
7 | PNU-142633 | Drug Info | Discontinued in Phase 2 | Migraine | [23] | |
8 | ALX-0646 | Drug Info | Discontinued in Phase 1 | Migraine | [24] | |
9 | Tidembersat | Drug Info | Discontinued in Phase 1 | Migraine | [25] | |
10 | BMS-181885 | Drug Info | Terminated | Migraine | [28] | |
11 | GR-127935 | Drug Info | Terminated | Major depressive disorder | [29], [30] | |
12 | L-694247 | Drug Info | Terminated | Migraine | [31], [32] | |
13 | PNU-109291 | Drug Info | Terminated | Migraine | [33], [34] | |
14 | VR-147 | Drug Info | Terminated | Migraine | [35] | |
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | Donitriptan | Drug Info | Preclinical | Migraine | [26], [27] | |
Mode of Action | [+] 4 Modes of Action | + | ||||
Agonist | [+] 32 Agonist drugs | + | ||||
1 | Almogran | Drug Info | [36] | |||
2 | Rizatriptan | Drug Info | [39] | |||
3 | Sumatriptan | Drug Info | [1], [40], [41], [42], [43] | |||
4 | FKB01MD | Drug Info | [44] | |||
5 | Neu-P11 | Drug Info | [45] | |||
6 | Tonabersat | Drug Info | [48], [49] | |||
7 | Alniditan | Drug Info | [50], [49], [50] | |||
8 | Avitriptan | Drug Info | [51], [49] | |||
9 | CP-122288 | Drug Info | [53], [49] | |||
10 | PNU-142633 | Drug Info | [56], [49] | |||
11 | ALX-0646 | Drug Info | [49] | |||
12 | BMS-181885 | Drug Info | [52], [49] | |||
13 | L-694247 | Drug Info | [59], [49] | |||
14 | PNU-109291 | Drug Info | [62], [49] | |||
15 | 1-naphthylpiperazine | Drug Info | [72], [66] | |||
16 | 2-methyl-5-HT | Drug Info | [76] | |||
17 | 5-CT | Drug Info | [38] | |||
18 | 7-methoxy-1-naphthylpiperazine | Drug Info | [71] | |||
19 | alpha-methyl-5-HT | Drug Info | [76] | |||
20 | BRL-15572 | Drug Info | [81] | |||
21 | dipropyl-5-CT | Drug Info | [72] | |||
22 | EDMT | Drug Info | [82] | |||
23 | lysergic acid | Drug Info | [76] | |||
24 | lysergol | Drug Info | [72] | |||
25 | SB 216641 | Drug Info | [81] | |||
26 | TFMPP | Drug Info | [38], [65] | |||
27 | [125I]GTI | Drug Info | [89] | |||
28 | [3H]5-CT | Drug Info | [90] | |||
29 | [3H]5-HT | Drug Info | [50] | |||
30 | [3H]8-OH-DPAT | Drug Info | [91] | |||
31 | [3H]eletriptan | Drug Info | [92] | |||
32 | [3H]sumatriptan | Drug Info | [92] | |||
Modulator | [+] 10 Modulator drugs | + | ||||
1 | Eletriptan | Drug Info | [37] | |||
2 | Frovatriptan | Drug Info | [37] | |||
3 | Zolmitriptan | Drug Info | [37] | |||
4 | NXN-188 | Drug Info | [46] | |||
5 | TGBA01AD | Drug Info | [47] | |||
6 | Elzasonan hydrochloride | Drug Info | [54] | |||
7 | IS-159 | Drug Info | [55] | |||
8 | Donitriptan | Drug Info | [57] | |||
9 | GR-127935 | Drug Info | [58] | |||
10 | VR-147 | Drug Info | [63], [49] | |||
Antagonist | [+] 12 Antagonist drugs | + | ||||
1 | Metergolin | Drug Info | [38] | |||
2 | BMS-181101 | Drug Info | [52], [49] | |||
3 | Tidembersat | Drug Info | [49] | |||
4 | 9-OH-risperidone | Drug Info | [79] | |||
5 | bufotenine | Drug Info | [76] | |||
6 | L-772,405 | Drug Info | [85] | |||
7 | m-chlorophenylpiperazine | Drug Info | [38] | |||
8 | MPDT | Drug Info | [82] | |||
9 | SB 272183 | Drug Info | [86] | |||
10 | SB 649915 | Drug Info | [87] | |||
11 | SB 714786 | Drug Info | [87] | |||
12 | [3H]GR 125,743 | Drug Info | [90] | |||
Inhibitor | [+] 53 Inhibitor drugs | + | ||||
1 | L-741604 | Drug Info | [60] | |||
2 | L-775606 | Drug Info | [61] | |||
3 | (+/-)-nantenine | Drug Info | [64] | |||
4 | (3-Chloro-phenyl)-piperazin-1-yl-methanone | Drug Info | [65] | |||
5 | 1,2,3,4-Tetrahydro-naphthalen-2-ylamine | Drug Info | [66] | |||
6 | 1-((S)-2-aminopropyl)-1H-indazol-6-ol | Drug Info | [67] | |||
7 | 1-(2,5-Dimethoxy-4-methyl-phenyl)-piperazine | Drug Info | [65] | |||
8 | 1-(2,5-Dimethoxy-phenyl)-piperazine | Drug Info | [65] | |||
9 | 1-(2,5-dimethoxyphenyl)propan-2-amine | Drug Info | [68] | |||
10 | 1-(2-Butoxy-phenyl)-piperazine | Drug Info | [69] | |||
11 | 1-(2-Ethoxy-phenyl)-piperazine | Drug Info | [69] | |||
12 | 1-(2-Fluoro-phenyl)-piperazine | Drug Info | [69] | |||
13 | 1-(2-Isopropoxy-phenyl)-piperazine | Drug Info | [69] | |||
14 | 1-(2-Methoxy-phenyl)-piperazine | Drug Info | [69] | |||
15 | 1-(3-(pentafluorosulfanyl)phenyl)propan-2-amine | Drug Info | [70] | |||
16 | 1-(3-Fluoro-phenyl)-piperazine | Drug Info | [69] | |||
17 | 1-(3-Nitro-phenyl)-piperazine | Drug Info | [69] | |||
18 | 1-(4-Bromo-2,5-dimethoxy-phenyl)-piperazine | Drug Info | [65] | |||
19 | 1-(7-Methoxy-naphthalen-2-yl)-piperazine | Drug Info | [71] | |||
20 | 1-Naphthalen-2-yl-piperazine | Drug Info | [66] | |||
21 | 2-(2,6-Dimethyl-benzyl)-4,5-dihydro-1H-imidazole | Drug Info | [73] | |||
22 | 2-(2-Amino-propyl)-5-bromo-4-methoxy-phenol | Drug Info | [68] | |||
23 | 2-(2-Methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [68] | |||
24 | 2-(3-Methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [68] | |||
25 | 2-(4-Bromo-2-methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [68] | |||
26 | 2-(4-Bromo-phenyl)-1-methyl-ethylamine | Drug Info | [68] | |||
27 | 2-(4-tert-Butyl-phenyl)-4,5-dihydro-1H-imidazole | Drug Info | [73] | |||
28 | 2-(5-Nonyloxy-1H-indol-3-yl)-ethylamine | Drug Info | [74] | |||
29 | 2-(5-Thiophen-2-yl-1H-indol-3-yl)-ethylamine | Drug Info | [75] | |||
30 | 2-Piperazin-1-yl-benzonitrile | Drug Info | [69] | |||
31 | 2-Piperazin-1-yl-phenol | Drug Info | [65] | |||
32 | 3-Amino-1-(2-amino-5-methoxy-phenyl)-propan-1-one | Drug Info | [65] | |||
33 | 5,6-dichloro-3,4-dihydroquinazolin-2-amine | Drug Info | [77] | |||
34 | 5-amino-3-(N-methylpiperidin-4-yl)-1H-indole | Drug Info | [61] | |||
35 | 5-chloro-3,4-dihydroquinazolin-2-amine | Drug Info | [77] | |||
36 | 5-chloro-4-methyl-3,4-dihydroquinazolin-2-amine | Drug Info | [77] | |||
37 | 5-Ethyl-3-(2-pyrrolidin-1-yl-ethyl)-1H-indole | Drug Info | [78] | |||
38 | 5-Isopropyl-3-(2-pyrrolidin-1-yl-ethyl)-1H-indole | Drug Info | [78] | |||
39 | 8-Methoxy-2-(4-methyl-piperazin-1-yl)-quinoline | Drug Info | [66] | |||
40 | 8-Methoxy-2-piperazin-1-yl-quinoline | Drug Info | [66] | |||
41 | 8-methoxy-4-methyl-3,4-dihydroquinazolin-2-amine | Drug Info | [77] | |||
42 | 8-Methoxy-quinolin-2-ylamine | Drug Info | [66] | |||
43 | AGROCLAVINE | Drug Info | [80] | |||
44 | Brolamfetamine | Drug Info | [68] | |||
45 | CHLOROPHENYLPIPERAZINE | Drug Info | [69] | |||
46 | Etisulergine | Drug Info | [83] | |||
47 | L-747201 | Drug Info | [84] | |||
48 | L-760790 | Drug Info | [60] | |||
49 | PHENYLPIPERAZINE | Drug Info | [66] | |||
50 | QUIPAZINE | Drug Info | [66] | |||
51 | SEROTONIN | Drug Info | [61] | |||
52 | WAY-466 | Drug Info | [88] | |||
53 | [2-(5-Ethyl-1H-indol-3-yl)-ethyl]-dimethyl-amine | Drug Info | [78] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Human Similarity Proteins
Human Pathway Affiliation
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
cAMP signaling pathway | hsa04024 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
|
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy | ||
Serotonergic synapse | hsa04726 | Affiliated Target |
|
Class: Organismal Systems => Nervous system | Pathway Hierarchy | ||
Taste transduction | hsa04742 | Affiliated Target |
|
Class: Organismal Systems => Sensory system | Pathway Hierarchy |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
1 | cAMP signaling pathway | |||||
2 | Neuroactive ligand-receptor interaction | |||||
3 | Serotonergic synapse | |||||
Panther Pathway | [+] 2 Panther Pathways | + | ||||
1 | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
2 | 5HT1 type receptor mediated signaling pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Serotonin receptors | |||||
2 | G alpha (i) signalling events | |||||
WikiPathways | [+] 5 WikiPathways | + | ||||
1 | Serotonin HTR1 Group and FOS Pathway | |||||
2 | Monoamine GPCRs | |||||
3 | GPCRs, Class A Rhodopsin-like | |||||
4 | GPCR ligand binding | |||||
5 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Irritable bowel syndrome: new agents targeting serotonin receptor subtypes. Drugs. 2001;61(3):317-32. | |||||
REF 2 | Drug information of Almogran, 2008. eduDrugs. | |||||
REF 3 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 40). | |||||
REF 4 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | |||||
REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7191). | |||||
REF 6 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 7 | Clinical pipeline report, company report or official report of Intelgenx. | |||||
REF 8 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 54). | |||||
REF 9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 60). | |||||
REF 10 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 020768. | |||||
REF 11 | ClinicalTrials.gov (NCT01489969) Sleep Laboratory Study to Investigate the Safety and Efficacy of Neu-P11 in Primary Insomnia Patients. U.S. National Institutes of Health. | |||||
REF 12 | ClinicalTrials.gov (NCT00920686) Study of NXN 188 for the Treatment of Migraine With Aura. U.S. National Institutes of Health. | |||||
REF 13 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. | |||||
REF 14 | ClinicalTrials.gov (NCT00534560) Dose Ranging Study of the Efficacy and Tolerability of Tonabersat in the Prophylaxis of Migraine Headache. U.S. National Institutes of Health. | |||||
REF 15 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 120). | |||||
REF 16 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006286) | |||||
REF 17 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002927) | |||||
REF 18 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 108). | |||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005177) | |||||
REF 20 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 110). | |||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005787) | |||||
REF 22 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005786) | |||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013927) | |||||
REF 24 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008400) | |||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010348) | |||||
REF 26 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 39). | |||||
REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012002) | |||||
REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007062) | |||||
REF 29 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 14). | |||||
REF 30 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002743) | |||||
REF 31 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 15). | |||||
REF 32 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003457) | |||||
REF 33 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3228). | |||||
REF 34 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010481) | |||||
REF 35 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023937) | |||||
REF 36 | Efficacy and tolerability of subcutaneous almotriptan for the treatment of acute migraine: a randomized, double-blind, parallel-group, dose-finding study. Clin Ther. 2001 Nov;23(11):1867-75. | |||||
REF 37 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
REF 38 | Primary structure and functional characterization of a human 5-HT1D-type serotonin receptor. Mol Pharmacol. 1991 Aug;40(2):143-8. | |||||
REF 39 | An introduction to migraine: from ancient treatment to functional pharmacology and antimigraine therapy. Proc West Pharmacol Soc. 2002;45:199-210. | |||||
REF 40 | 5-Hydroxytryptamine(1F) receptors do not participate in vasoconstriction: lack of vasoconstriction to LY344864, a selective serotonin(1F) receptor agonist in rabbit saphenous vein. J Pharmacol Exp Ther. 1999 Sep;290(3):935-9. | |||||
REF 41 | 5-Hydroxytryptamine receptor agonists for the abortive treatment of vascular headaches block mast cell, endothelial and platelet activation within the rat dura mater after trigeminal stimulation. Brain Res. 1992 Jun 26;583(1-2):137-49. | |||||
REF 42 | Novel approaches to the treatment of nausea and vomiting. Dig Dis. 1999;17(3):125-32. | |||||
REF 43 | Serotonin in migraine: theories, animal models and emerging therapies. Prog Drug Res. 1998;51:219-44. | |||||
REF 44 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 45 | Clinical pipeline report, company report or official report of Neurim Pharmaceuticals. | |||||
REF 46 | Company report (NeurAxon) | |||||
REF 47 | Company report (Fabrekramer) | |||||
REF 48 | The potential anti-migraine compound SB-220453 does not contract human isolated blood vessels or myocardium; a comparison with sumatriptan. Cephalalgia. 2000 Jul;20(6):538-45. | |||||
REF 49 | Sustained pain relief with dihydroergotamine in migraine is potentially due to persistent binding to 5-HT1B and 5-HT1D receptors. . The Journal of Headache and Pain 201314(Suppl 1):P75. | |||||
REF 50 | Agonistic properties of alniditan, sumatriptan and dihydroergotamine on human 5-HT1B and 5-HT1D receptors expressed in various mammalian cell lines. Br J Pharmacol. 1998 Apr;123(8):1655-65. | |||||
REF 51 | Safety trial with the 5HT1B/1D agonist avitriptan (BMS-180048) in patients with migraine who have experienced pressure, tightness, and/or pain in the chest, neck, and/or throat following sumatriptan.Cephalalgia. 1998 Oct;18(8):546-51. | |||||
REF 52 | Sensitive triple-quadrupole mass spectrometric assay for the determination of BMS-181885, a 5-HT1 agonist, in human plasma following solid phase extraction. Biomed Chromatogr. 1999 Oct;13(6):425-30. | |||||
REF 53 | The 5-HT1D receptor antagonist GR-127,935 prevents inhibitory effects of sumatriptan but not CP-122,288 and 5-CT on neurogenic plasma extravasation within guinea pig dura mater. Neuropharmacology. 1997 Jan;36(1):83-91. | |||||
REF 54 | DOI: 10.1002/9781118541203.xen439 | |||||
REF 55 | Pronounced effect of caprylocaproyl macrogolglycerides on nasal absorption of IS-159, a peptide serotonin 1B/1D-receptor agonist. Clin Pharmacol Ther. 2000 Aug;68(2):114-21. | |||||
REF 56 | Further characterization of the 5-HT1 receptors mediating cardiac sympatho-inhibition in pithed rats: pharmacological correlation with the 5-HT1B a... Naunyn Schmiedebergs Arch Pharmacol. 2004 Feb;369(2):220-7. | |||||
REF 57 | Donitriptan, but not sumatriptan, inhibits capsaicin-induced canine external carotid vasodilatation via 5-HT1B rather than 5-HT1D receptors.Br J Pharmacol.2006 Sep;149(1):82-91. | |||||
REF 58 | GR127935: a potent and selective 5-HT1D receptor antagonist.Behav Brain Res.1996;73(1-2):157-61. | |||||
REF 59 | L-694,247: a potent 5-HT1D receptor agonist. Br J Pharmacol. 1993 Nov;110(3):1196-200. | |||||
REF 60 | 3-(Piperazinylpropyl)indoles: selective, orally bioavailable h5-HT1D receptor agonists as potential antimigraine agents. J Med Chem. 1999 Feb 25;42(4):691-705. | |||||
REF 61 | Designing selective, high affinity ligands of 5-HT1D receptor by covalent dimerization of 5-HT1F ligands derived from 4-fluoro-N-[3-(1-methyl-4-pip... J Med Chem. 2008 Jun 26;51(12):3609-16. | |||||
REF 62 | Role of 5-HT(1) receptor subtypes in the modulation of pain and synaptic transmission in rat spinal superficial dorsal horn. Br J Pharmacol. 2012 Mar;165(6):1956-65. | |||||
REF 63 | US patent application no. 2010,0112,050, Dosage form for insertion into the mouth. | |||||
REF 64 | Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. | |||||
REF 65 | Synthesis and evaluation of phenyl- and benzoylpiperazines as potential serotonergic agents. J Med Chem. 1986 May;29(5):630-4. | |||||
REF 66 | 5-HT1 and 5-HT2 binding characteristics of some quipazine analogues. J Med Chem. 1986 Nov;29(11):2375-80. | |||||
REF 67 | 1-((S)-2-aminopropyl)-1H-indazol-6-ol: a potent peripherally acting 5-HT2 receptor agonist with ocular hypotensive activity. J Med Chem. 2006 Jan 12;49(1):318-28. | |||||
REF 68 | 5-HT1 and 5-HT2 binding characteristics of 1-(2,5-dimethoxy-4-bromophenyl)-2-aminopropane analogues. J Med Chem. 1986 Feb;29(2):194-9. | |||||
REF 69 | Activity of aromatic substituted phenylpiperazines lacking affinity for dopamine binding sites in a preclinical test of antipsychotic efficacy. J Med Chem. 1989 May;32(5):1052-6. | |||||
REF 70 | The synthesis and biological activity of pentafluorosulfanyl analogs of fluoxetine, fenfluramine, and norfenfluramine. Bioorg Med Chem. 2007 Nov 1;15(21):6659-66. | |||||
REF 71 | 5-HT1B receptor antagonist properties of novel arylpiperazide derivatives of 1-naphthylpiperazine. J Med Chem. 1997 Nov 21;40(24):3974-8. | |||||
REF 72 | Human serotonin 1D receptor is encoded by a subfamily of two distinct genes: 5-HT1D alpha and 5-HT1D beta. Proc Natl Acad Sci U S A. 1992 Apr 15;89(8):3630-4. | |||||
REF 73 | 2-(Anilino)imidazolines and 2-(benzyl)imidazoline derivatives as h5-HT1D serotonin receptor ligands. Bioorg Med Chem Lett. 2004 Sep 20;14(18):4697-9. | |||||
REF 74 | 5-(Nonyloxy)tryptamine: a novel high-affinity 5-HT1D beta serotonin receptor agonist. J Med Chem. 1994 Sep 2;37(18):2828-30. | |||||
REF 75 | 5-Thienyltryptamine derivatives as serotonin 5-HT1B/1D receptor agonists: potential treatments for migraine. Bioorg Med Chem Lett. 2000 May 1;10(9):903-5. | |||||
REF 76 | Alniditan, a new 5-hydroxytryptamine1D agonist and migraine-abortive agent: ligand-binding properties of human 5-hydroxytryptamine1D alpha, human 5-hydroxytryptamine1D beta, and calf 5-hydroxytryptamine1D receptors investigated with [3H]5-hydroxytryptamine and [3H]alniditan. Mol Pharmacol. 1996 Dec;50(6):1567-80. | |||||
REF 77 | Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61. | |||||
REF 78 | 5-Alkyltryptamine derivatives as highly selective and potent 5-HT1D receptor agonists. Bioorg Med Chem Lett. 2000 Aug 7;10(15):1707-9. | |||||
REF 79 | Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl). 1996 Mar;124(1-2):57-73. | |||||
REF 80 | Ergolines as selective 5-HT1 agonists. J Med Chem. 1988 Aug;31(8):1512-9. | |||||
REF 81 | SB-216641 and BRL-15572--compounds to pharmacologically discriminate h5-HT1B and h5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1997 Sep;356(3):312-20. | |||||
REF 82 | 2-Substituted tryptamines: agents with selectivity for 5-HT(6) serotonin receptors. J Med Chem. 2000 Mar 9;43(5):1011-8. | |||||
REF 83 | Resolution and absolute configuration of the potent dopamine agonist N,N-diethyl-N'-[(3 alpha, 4a alpha, 10a beta)-1,2,3,4,4a,5,10,10a- -octahydro-... J Med Chem. 1985 Oct;28(10):1540-2. | |||||
REF 84 | Selective, orally active 5-HT1D receptor agonists as potential antimigraine agents. J Med Chem. 1997 Oct 24;40(22):3501-3. | |||||
REF 85 | 3-[3-(Piperidin-1-yl)propyl]indoles as highly selective h5-HT(1D) receptor agonists. J Med Chem. 1999 Dec 2;42(24):4981-5001. | |||||
REF 86 | SB-272183, a selective 5-HT(1A), 5-HT(1B) and 5-HT(1D) receptor antagonist in native tissue. Br J Pharmacol. 2001 Jul;133(6):797-806. | |||||
REF 87 | Discovery of the first potent, selective 5-hydroxytryptamine1D receptor antagonist. J Med Chem. 2005 May 19;48(10):3478-80. | |||||
REF 88 | Discovery of 5-arylsulfonamido-3-(pyrrolidin-2-ylmethyl)-1H-indole derivatives as potent, selective 5-HT6 receptor agonists and antagonists. J Med Chem. 2005 Jan 27;48(2):353-6. | |||||
REF 89 | Autoradiographic characterisation and localisation of 5-HT1D compared to 5-HT1B binding sites in rat brain. Naunyn Schmiedebergs Arch Pharmacol. 1993 Jun;347(6):569-82. | |||||
REF 90 | Serotonin 5-HT1B and 5-HT1D receptors form homodimers when expressed alone and heterodimers when co-expressed. FEBS Lett. 1999 Jul 30;456(1):63-7. | |||||
REF 91 | Actions of roxindole at recombinant human dopamine D2, D3 and D4 and serotonin 5-HT1A, 5-HT1B and 5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1999 Jun;359(6):447-53. | |||||
REF 92 | Characterisation of the 5-HT receptor binding profile of eletriptan and kinetics of [3H]eletriptan binding at human 5-HT1B and 5-HT1D receptors. Eur J Pharmacol. 1999 Mar 5;368(2-3):259-68. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.